BLASTX nr result
ID: Ephedra26_contig00023946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00023946 (986 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006431535.1| hypothetical protein CICLE_v10003979mg, part... 52 2e-06 >ref|XP_006431535.1| hypothetical protein CICLE_v10003979mg, partial [Citrus clementina] gi|557533657|gb|ESR44775.1| hypothetical protein CICLE_v10003979mg, partial [Citrus clementina] Length = 314 Score = 52.0 bits (123), Expect(2) = 2e-06 Identities = 38/126 (30%), Positives = 58/126 (46%), Gaps = 1/126 (0%) Frame = +2 Query: 101 FGYVGEHNQSGMTQQNLIDEAKLVFFQTQNTTFKHESCWKVLQNSPKWKLSLEKNTKKRP 280 F + QSG+ +Q+ I AK ++ + T F E CW +L++ PKW + +K+ Sbjct: 119 FSQIENRQQSGVNEQDKIMNAKALYKEMFKTKFTFEHCWNILRHHPKWLTDNQAKREKKK 178 Query: 281 KISLTTLDTCNSAPCSKXXXXXXXXXXXXXXXLLDVDMDVAPTLDKVAERPNGQKSEKGK 460 IS ++ +S+ LD + D T ERP G+KSEK K Sbjct: 179 GISASSPGISSSSTAKTPIN-------------LD-ENDNGDTNFVDLERPLGKKSEKRK 224 Query: 461 -RKKNS 475 R+KNS Sbjct: 225 IREKNS 230 Score = 26.9 bits (58), Expect(2) = 2e-06 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +3 Query: 15 KFIPKERTAKALMNRWCNISTSISKFCGLLATL 113 K ER K+LM RW I + +KF G + + Sbjct: 90 KNFESERDEKSLMQRWSKIQQATNKFHGCFSQI 122