BLASTX nr result
ID: Ephedra26_contig00023634
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00023634 (706 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006838556.1| hypothetical protein AMTR_s00002p00205450 [A... 62 2e-07 gb|EOX93806.1| Tetratricopeptide repeat (TPR)-like superfamily p... 60 5e-07 ref|XP_002301807.2| hypothetical protein POPTR_0002s24950g [Popu... 60 9e-07 ref|XP_002534359.1| pentatricopeptide repeat-containing protein,... 60 9e-07 ref|XP_004293124.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_004144398.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 >ref|XP_006838556.1| hypothetical protein AMTR_s00002p00205450 [Amborella trichopoda] gi|548841062|gb|ERN01125.1| hypothetical protein AMTR_s00002p00205450 [Amborella trichopoda] Length = 372 Score = 61.6 bits (148), Expect = 2e-07 Identities = 37/122 (30%), Positives = 62/122 (50%) Frame = +2 Query: 341 RDTVELARKFELCIQKLPENFTAENIDTLIQEQTNVDLAHDIFNWSREQMRFKHKHTSYI 520 R L ++FE I KL FT +++D ++ Q++ DLA DIF W+ Q ++H +Y Sbjct: 47 RSRTPLEKQFESWIHKLKPGFTPQDVDDALRNQSDPDLALDIFRWTSNQRHYRHTDLTYY 106 Query: 521 HILSLLWQVGRRDPALKLMKDVITKLSSSRTSYLYPGNLLNTEVFNVMICKYCQADLLGD 700 +L +L R K ++ +I ++ + S P +FN +I +C+ LLG Sbjct: 107 TMLRILASENR----FKQIETLIAEVMAGACSPSPP-------LFNTIINHFCKRKLLGQ 155 Query: 701 AI 706 AI Sbjct: 156 AI 157 >gb|EOX93806.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 382 Score = 60.5 bits (145), Expect = 5e-07 Identities = 32/84 (38%), Positives = 46/84 (54%) Frame = +2 Query: 338 PRDTVELARKFELCIQKLPENFTAENIDTLIQEQTNVDLAHDIFNWSREQMRFKHKHTSY 517 PR L +FE IQKL FT ++D ++ Q + DLA DIF W+ Q +KH +Y Sbjct: 57 PRTRTPLETQFETWIQKLKPGFTTADVDAALRAQPDADLALDIFRWTALQRGYKHTDATY 116 Query: 518 IHILSLLWQVGRRDPALKLMKDVI 589 + I+ LL R A L+++VI Sbjct: 117 LTIIKLLISAKRYRHAETLIEEVI 140 >ref|XP_002301807.2| hypothetical protein POPTR_0002s24950g [Populus trichocarpa] gi|550345772|gb|EEE81080.2| hypothetical protein POPTR_0002s24950g [Populus trichocarpa] Length = 387 Score = 59.7 bits (143), Expect = 9e-07 Identities = 29/78 (37%), Positives = 46/78 (58%) Frame = +2 Query: 356 LARKFELCIQKLPENFTAENIDTLIQEQTNVDLAHDIFNWSREQMRFKHKHTSYIHILSL 535 L +FE Q L FT ++DT I+ Q++ DLA DIF W+ +Q +KH H +Y+ ++ + Sbjct: 66 LETQFETWTQNLKPGFTPTDVDTAIRAQSDPDLALDIFRWTAQQRNYKHNHITYLTVIKI 125 Query: 536 LWQVGRRDPALKLMKDVI 589 L R A L+++VI Sbjct: 126 LISGRRYRQAETLIEEVI 143 >ref|XP_002534359.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223525434|gb|EEF28024.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 382 Score = 59.7 bits (143), Expect = 9e-07 Identities = 35/118 (29%), Positives = 57/118 (48%) Frame = +2 Query: 341 RDTVELARKFELCIQKLPENFTAENIDTLIQEQTNVDLAHDIFNWSREQMRFKHKHTSYI 520 R L +FE Q L FT ++ T ++ Q++ DLA+DIF W+ +Q +KH H +Y Sbjct: 56 RTRTPLETQFETWTQTLKPGFTPTDVQTALRSQSDPDLAYDIFRWTAQQRNYKHSHLTYF 115 Query: 521 HILSLLWQVGRRDPALKLMKDVITKLSSSRTSYLYPGNLLNTEVFNVMICKYCQADLL 694 ++ +L R A L+++VI +N +++N MI C LL Sbjct: 116 AMIKILIDGKRYRHAETLVEEVIAGACE-----------MNVQLYNSMIRFCCGRKLL 162 >ref|XP_004293124.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 370 Score = 58.5 bits (140), Expect = 2e-06 Identities = 32/104 (30%), Positives = 55/104 (52%) Frame = +2 Query: 278 PSLGMTKFETRYEKEPIKFAPRDTVELARKFELCIQKLPENFTAENIDTLIQEQTNVDLA 457 PSL + P F R +E ++FE I KL F ++D ++ Q++ DLA Sbjct: 25 PSLYHRLLSSSARNPPDSFRTRTPLE--KQFETWIHKLKPGFGPPDVDEALKAQSDPDLA 82 Query: 458 HDIFNWSREQMRFKHKHTSYIHILSLLWQVGRRDPALKLMKDVI 589 DIF W+ +Q +KH H++Y+ ++ +L R A L+++V+ Sbjct: 83 LDIFRWTAQQRNYKHSHSTYLTMIKILIDGRRYRHAETLLEEVV 126 >ref|XP_004144398.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Cucumis sativus] gi|449516331|ref|XP_004165200.1| PREDICTED: pentatricopeptide repeat-containing protein At3g25210, mitochondrial-like [Cucumis sativus] Length = 393 Score = 58.5 bits (140), Expect = 2e-06 Identities = 41/145 (28%), Positives = 72/145 (49%) Frame = +2 Query: 155 SPFQSSKLANPSGFPSYPNNNSNSRILTPRAWTMQRRQKHAPSLGMTKFETRYEKEPIKF 334 SPFQS L NP PS+ ++ + P + + + +L + K T+ Sbjct: 21 SPFQS--LLNPI-LPSHLHHRFLCSLSPPSSALLPPQNSDNLNLPIPKVRTQ-------- 69 Query: 335 APRDTVELARKFELCIQKLPENFTAENIDTLIQEQTNVDLAHDIFNWSREQMRFKHKHTS 514 L ++FE +QKL F+ +++ +Q Q++ DLA D+F W+ +Q +KH H + Sbjct: 70 -----TPLEKQFESWVQKLKPGFSPSDVNEALQAQSDPDLALDLFRWTAQQRGYKHNHLT 124 Query: 515 YIHILSLLWQVGRRDPALKLMKDVI 589 Y+ I+ +L R A L+++VI Sbjct: 125 YLTIIKILIYRRRCHLAETLVEEVI 149