BLASTX nr result
ID: Ephedra26_contig00022596
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00022596 (444 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB88628.1| 85 kDa cold acclimation protein [Spinacia oleracea] 65 9e-09 >gb|AAB88628.1| 85 kDa cold acclimation protein [Spinacia oleracea] Length = 535 Score = 65.1 bits (157), Expect = 9e-09 Identities = 40/98 (40%), Positives = 53/98 (54%), Gaps = 11/98 (11%) Frame = +1 Query: 184 PAPPLQYNKETAKHGHGNEEGA-GIMDKIDDS---KSEEDHNQYHHEEGDEKEKRYMDKI 351 PAP YN H H +EE ++DKI D + E+ N YHH + +EK+ +DKI Sbjct: 201 PAPDHNYNTH---HVHQDEENKDSVLDKIKDKLPGQHEDKKNDYHHHQEEEKKDSVLDKI 257 Query: 352 K-------EQKNEEYHYHGMEGEKKLGLMDKFKQKLHG 444 K E K +YH+H E EKK G++DK K KL G Sbjct: 258 KDKMSGQHEDKKNDYHHH-QEEEKKGGVLDKIKDKLPG 294