BLASTX nr result
ID: Ephedra26_contig00022383
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00022383 (433 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006829637.1| hypothetical protein AMTR_s00122p00090920 [A... 57 2e-06 >ref|XP_006829637.1| hypothetical protein AMTR_s00122p00090920 [Amborella trichopoda] gi|548835148|gb|ERM97053.1| hypothetical protein AMTR_s00122p00090920 [Amborella trichopoda] Length = 514 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/81 (30%), Positives = 48/81 (59%) Frame = -1 Query: 349 SLEEIRGDINEQDHEKTRILSEMNQINEEVSNTDSFSNIENLVSVFREIKHLETKEANFH 170 S+E + G ++EQDH KT +L+E+ + +++ + S + L+S ++K LE +EA F Sbjct: 247 SIEVLHGSLSEQDHRKTSVLNEIQLLTQKIDQAGAISLFQRLMSHLEQLKLLEKQEAEFR 306 Query: 169 VHCKRVLVGLEAQISDLDAHA 107 HCK+ L+ ++ ++ A Sbjct: 307 SHCKQKRSDLQDEVIRVEKEA 327