BLASTX nr result
ID: Ephedra26_contig00022187
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00022187 (597 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006849632.1| hypothetical protein AMTR_s00024p00219730 [A... 67 5e-09 >ref|XP_006849632.1| hypothetical protein AMTR_s00024p00219730 [Amborella trichopoda] gi|548853207|gb|ERN11213.1| hypothetical protein AMTR_s00024p00219730 [Amborella trichopoda] Length = 873 Score = 66.6 bits (161), Expect = 5e-09 Identities = 31/74 (41%), Positives = 47/74 (63%), Gaps = 2/74 (2%) Frame = +3 Query: 3 VPHFMPFANMYGSSFSTPFETPALPYASYAFPSYVPALYSGVPIQQSDFMRMGS--GTTF 176 +PH PF ++YG+ + PF+ +P + YA P Y+P++Y+G+P+ FMRMGS Sbjct: 530 IPHVRPFTSLYGAPGAMPFDPSMVPVSPYAIPPYMPSIYTGMPV-PCGFMRMGSLMPPMV 588 Query: 177 VAPERPLSKEEFME 218 +RPLS+ EFME Sbjct: 589 AGADRPLSRVEFME 602