BLASTX nr result
ID: Ephedra26_contig00021827
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00021827 (463 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006379760.1| hypothetical protein POPTR_0008s12840g, part... 56 6e-06 ref|XP_002526019.1| homeobox protein, putative [Ricinus communis... 55 7e-06 >ref|XP_006379760.1| hypothetical protein POPTR_0008s12840g, partial [Populus trichocarpa] gi|550332943|gb|ERP57557.1| hypothetical protein POPTR_0008s12840g, partial [Populus trichocarpa] Length = 205 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/43 (67%), Positives = 30/43 (69%) Frame = +1 Query: 334 DECRGVEGGSCSPILPPRKKLRLSKEQAALLEESFRQHHTLTP 462 DE GG PPRKKLRLSKEQ+ LLEESFRQHHTL P Sbjct: 65 DEEESTNGG------PPRKKLRLSKEQSRLLEESFRQHHTLNP 101 >ref|XP_002526019.1| homeobox protein, putative [Ricinus communis] gi|223534666|gb|EEF36359.1| homeobox protein, putative [Ricinus communis] Length = 237 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = +1 Query: 331 NDECRGVEGGSCSPILPPRKKLRLSKEQAALLEESFRQHHTLTP 462 ++E + GG PPRKKLRLSKEQ+ LLEESFRQHHTL P Sbjct: 57 DEEESNINGG------PPRKKLRLSKEQSRLLEESFRQHHTLNP 94