BLASTX nr result
ID: Ephedra26_contig00021314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00021314 (732 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFG45030.1| hypothetical protein 0_15227_01, partial [Pinus t... 68 3e-09 gb|AEW07955.1| hypothetical protein 0_15227_01, partial [Pinus r... 68 3e-09 >gb|AFG45030.1| hypothetical protein 0_15227_01, partial [Pinus taeda] gi|383128709|gb|AFG45031.1| hypothetical protein 0_15227_01, partial [Pinus taeda] gi|383128711|gb|AFG45032.1| hypothetical protein 0_15227_01, partial [Pinus taeda] gi|383128713|gb|AFG45033.1| hypothetical protein 0_15227_01, partial [Pinus taeda] gi|383128715|gb|AFG45034.1| hypothetical protein 0_15227_01, partial [Pinus taeda] gi|383128717|gb|AFG45035.1| hypothetical protein 0_15227_01, partial [Pinus taeda] gi|383128719|gb|AFG45036.1| hypothetical protein 0_15227_01, partial [Pinus taeda] gi|383128721|gb|AFG45037.1| hypothetical protein 0_15227_01, partial [Pinus taeda] gi|383128723|gb|AFG45038.1| hypothetical protein 0_15227_01, partial [Pinus taeda] gi|383128725|gb|AFG45039.1| hypothetical protein 0_15227_01, partial [Pinus taeda] gi|383128727|gb|AFG45040.1| hypothetical protein 0_15227_01, partial [Pinus taeda] gi|383128729|gb|AFG45041.1| hypothetical protein 0_15227_01, partial [Pinus taeda] gi|383128731|gb|AFG45042.1| hypothetical protein 0_15227_01, partial [Pinus taeda] Length = 109 Score = 68.2 bits (165), Expect = 3e-09 Identities = 34/60 (56%), Positives = 40/60 (66%) Frame = -1 Query: 732 LEEFDKDEMRNILLLGLACSHPIPKERPNMRMVQQILCKDIXXXXXXXXXXAFVWHSPGI 553 L EFDKDEM +LL+G+ACSHP P+ERP MR V QIL KD AFVW +PG+ Sbjct: 37 LNEFDKDEMICMLLVGMACSHPNPQERPTMRQVLQILTKDAPPPLMPLFKPAFVWPAPGM 96 >gb|AEW07955.1| hypothetical protein 0_15227_01, partial [Pinus radiata] Length = 109 Score = 68.2 bits (165), Expect = 3e-09 Identities = 34/60 (56%), Positives = 40/60 (66%) Frame = -1 Query: 732 LEEFDKDEMRNILLLGLACSHPIPKERPNMRMVQQILCKDIXXXXXXXXXXAFVWHSPGI 553 L EFDKDEM +LL+G+ACSHP P+ERP MR V QIL KD AFVW +PG+ Sbjct: 37 LNEFDKDEMICMLLVGMACSHPNPQERPTMRQVLQILTKDAPPPLMPLFKPAFVWPAPGM 96