BLASTX nr result
ID: Ephedra26_contig00021298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00021298 (912 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_650056.1| CG17187 [Drosophila melanogaster] gi|23170975|g... 57 1e-05 gb|EHJ70687.1| DnaJ-like protein 9 [Danaus plexippus] 57 1e-05 >ref|NP_650056.1| CG17187 [Drosophila melanogaster] gi|23170975|gb|AAF54616.2| CG17187 [Drosophila melanogaster] gi|28316956|gb|AAO39499.1| RE47242p [Drosophila melanogaster] gi|220948572|gb|ACL86829.1| CG17187-PA [synthetic construct] gi|220957846|gb|ACL91466.1| CG17187-PA [synthetic construct] Length = 299 Score = 57.0 bits (136), Expect = 1e-05 Identities = 33/78 (42%), Positives = 46/78 (58%), Gaps = 1/78 (1%) Frame = -1 Query: 450 YDVLGIKLTDDPNIIKKAYQRKSLTLHPDKQHGQPEEVRRQRAAEFREITKAREVLSG-S 274 YD+LGI L D N I+KAY++K+L HPDK P+ V R F E++KA E+L+ S Sbjct: 12 YDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVER-----FHELSKALEILTDES 66 Query: 273 RRWEYEKRIHLVKCRKHR 220 R Y+K + K + R Sbjct: 67 ARAAYDKVLKAKKAAELR 84 >gb|EHJ70687.1| DnaJ-like protein 9 [Danaus plexippus] Length = 493 Score = 57.0 bits (136), Expect = 1e-05 Identities = 25/62 (40%), Positives = 42/62 (67%) Frame = -1 Query: 453 WYDVLGIKLTDDPNIIKKAYQRKSLTLHPDKQHGQPEEVRRQRAAEFREITKAREVLSGS 274 +Y +LGI+ T + IKKAY++++L HPD+ G P+ RR++ F+E+ +A EVLS Sbjct: 378 YYKILGIEKTASEDDIKKAYRKRALVHHPDRHAGAPDNERREQERRFKEVGEAYEVLSDP 437 Query: 273 RR 268 ++ Sbjct: 438 KK 439