BLASTX nr result
ID: Ephedra26_contig00021259
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00021259 (604 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006857693.1| hypothetical protein AMTR_s00061p00165490 [A... 58 2e-06 >ref|XP_006857693.1| hypothetical protein AMTR_s00061p00165490 [Amborella trichopoda] gi|548861789|gb|ERN19160.1| hypothetical protein AMTR_s00061p00165490 [Amborella trichopoda] Length = 1139 Score = 58.2 bits (139), Expect = 2e-06 Identities = 34/69 (49%), Positives = 46/69 (66%), Gaps = 2/69 (2%) Frame = +1 Query: 1 NVELDAAHVNKESGEVLKLKQQVDNLKRALVKKASEIAQLQHTRLSLSMFE--KSGLIAE 174 +VEL AA NKESGEV +LKQ++ NLK AL KK +E+ QLQ ++ S S E ++ + Sbjct: 743 SVELGAASSNKESGEVKELKQEISNLKLALEKKEAEVEQLQGSKYSRSSSETQRTRIAVS 802 Query: 175 PGNKPRQSS 201 P N RQ+S Sbjct: 803 PINLQRQAS 811