BLASTX nr result
ID: Ephedra26_contig00020659
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00020659 (446 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002964855.1| hypothetical protein SELMODRAFT_230534 [Sela... 55 1e-05 >ref|XP_002964855.1| hypothetical protein SELMODRAFT_230534 [Selaginella moellendorffii] gi|300167088|gb|EFJ33693.1| hypothetical protein SELMODRAFT_230534 [Selaginella moellendorffii] Length = 1255 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/46 (56%), Positives = 32/46 (69%) Frame = +3 Query: 3 MCIHPLCRQFLKSLEFSQILLRLGQSPDPAIIKCIKRITSKFPDAS 140 MCIH CRQ+L+SLE ++LL+L S D IIK + RI KFPD S Sbjct: 1204 MCIHAPCRQYLRSLELFRVLLQLKNSTDSTIIKYLNRIMCKFPDIS 1249