BLASTX nr result
ID: Ephedra26_contig00020385
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00020385 (469 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006845688.1| hypothetical protein AMTR_s00019p00236380 [A... 58 1e-06 gb|EOY26249.1| Pentatricopeptide repeat-containing protein, puta... 55 1e-05 >ref|XP_006845688.1| hypothetical protein AMTR_s00019p00236380 [Amborella trichopoda] gi|548848260|gb|ERN07363.1| hypothetical protein AMTR_s00019p00236380 [Amborella trichopoda] Length = 491 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/63 (38%), Positives = 39/63 (61%) Frame = -1 Query: 442 LMSFFCELGQLDMAMKLWNHVIDQGCFFQYCDVKLLVEKLCASGRWQTAYDCCNQLVEKG 263 LM FC M +KLWN++++ GC + LLV +LC G+ + AY+CC Q++++G Sbjct: 379 LMKCFCYSDCYKMGLKLWNYLVEMGCCPHGHALDLLVMELCRKGKLEEAYECCRQVLDRG 438 Query: 262 KPP 254 + P Sbjct: 439 RLP 441 >gb|EOY26249.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 512 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/61 (37%), Positives = 39/61 (63%) Frame = -1 Query: 442 LMSFFCELGQLDMAMKLWNHVIDQGCFFQYCDVKLLVEKLCASGRWQTAYDCCNQLVEKG 263 LM +FCE LD+ + LW++++++G + LLV LC+ GR A+ CC Q++E+G Sbjct: 403 LMKYFCENQNLDLGLNLWDYLVEKGYCPHSHALDLLVTGLCSRGRLPEAFVCCKQMLERG 462 Query: 262 K 260 + Sbjct: 463 R 463