BLASTX nr result
ID: Ephedra26_contig00020019
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00020019 (531 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006847859.1| hypothetical protein AMTR_s00029p00078080 [A... 58 2e-06 ref|XP_003580816.1| PREDICTED: dolichyl-diphosphooligosaccharide... 58 2e-06 dbj|BAJ87792.1| predicted protein [Hordeum vulgare subsp. vulgare] 58 2e-06 ref|XP_006653023.1| PREDICTED: dolichyl-diphosphooligosaccharide... 57 2e-06 ref|XP_006353938.1| PREDICTED: dolichyl-diphosphooligosaccharide... 57 2e-06 ref|XP_004960084.1| PREDICTED: dolichyl-diphosphooligosaccharide... 57 2e-06 ref|XP_004235404.1| PREDICTED: dolichyl-diphosphooligosaccharide... 57 2e-06 ref|XP_002448765.1| hypothetical protein SORBIDRAFT_06g032800 [S... 57 2e-06 gb|ACR37140.1| unknown [Zea mays] 57 2e-06 ref|NP_001168720.1| hypothetical protein [Zea mays] gi|223950395... 57 2e-06 ref|NP_001131374.1| oligosaccharyl transferase STT3 subunit [Zea... 57 2e-06 gb|ACF79760.1| unknown [Zea mays] 57 2e-06 ref|NP_001054248.1| Os04g0675500 [Oryza sativa Japonica Group] g... 57 2e-06 gb|EXB95062.1| hypothetical protein L484_003540 [Morus notabilis] 57 3e-06 ref|XP_004299463.1| PREDICTED: dolichyl-diphosphooligosaccharide... 57 3e-06 ref|XP_002269119.2| PREDICTED: dolichyl-diphosphooligosaccharide... 57 3e-06 emb|CBI35275.3| unnamed protein product [Vitis vinifera] 57 3e-06 emb|CAN67600.1| hypothetical protein VITISV_012281 [Vitis vinifera] 57 3e-06 ref|XP_006415033.1| hypothetical protein EUTSA_v10006908mg [Eutr... 57 3e-06 ref|XP_006306856.1| hypothetical protein CARUB_v10008402mg [Caps... 57 3e-06 >ref|XP_006847859.1| hypothetical protein AMTR_s00029p00078080 [Amborella trichopoda] gi|548851164|gb|ERN09440.1| hypothetical protein AMTR_s00029p00078080 [Amborella trichopoda] Length = 733 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 530 KNVTLEYLEEAYTTSNWIVRIYKVKPPVNR 441 K+V LEYLEEA+TTSNWIVRIYKVKPP NR Sbjct: 703 KDVKLEYLEEAFTTSNWIVRIYKVKPPSNR 732 >ref|XP_003580816.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3-like [Brachypodium distachyon] Length = 723 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 530 KNVTLEYLEEAYTTSNWIVRIYKVKPPVNR 441 K+V LEYLEEA+TTSNWIVRIYKVKPP NR Sbjct: 693 KDVKLEYLEEAFTTSNWIVRIYKVKPPKNR 722 >dbj|BAJ87792.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 725 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 530 KNVTLEYLEEAYTTSNWIVRIYKVKPPVNR 441 K+V LEYLEEA+TTSNWIVRIYKVKPP NR Sbjct: 695 KDVKLEYLEEAFTTSNWIVRIYKVKPPKNR 724 >ref|XP_006653023.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B-like [Oryza brachyantha] Length = 720 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 530 KNVTLEYLEEAYTTSNWIVRIYKVKPPVNR 441 K++ LEYLEEA+TTSNWIVRIYKVKPP NR Sbjct: 690 KDIKLEYLEEAFTTSNWIVRIYKVKPPKNR 719 >ref|XP_006353938.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B-like [Solanum tuberosum] Length = 725 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 530 KNVTLEYLEEAYTTSNWIVRIYKVKPPVNR 441 K++ LEYLEEA+TTSNWIVRIYKVKPP NR Sbjct: 695 KDIKLEYLEEAFTTSNWIVRIYKVKPPKNR 724 >ref|XP_004960084.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B-like [Setaria italica] Length = 720 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 530 KNVTLEYLEEAYTTSNWIVRIYKVKPPVNR 441 K++ LEYLEEA+TTSNWIVRIYKVKPP NR Sbjct: 690 KDIKLEYLEEAFTTSNWIVRIYKVKPPKNR 719 >ref|XP_004235404.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B-like [Solanum lycopersicum] Length = 725 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 530 KNVTLEYLEEAYTTSNWIVRIYKVKPPVNR 441 K++ LEYLEEA+TTSNWIVRIYKVKPP NR Sbjct: 695 KDIKLEYLEEAFTTSNWIVRIYKVKPPKNR 724 >ref|XP_002448765.1| hypothetical protein SORBIDRAFT_06g032800 [Sorghum bicolor] gi|241939948|gb|EES13093.1| hypothetical protein SORBIDRAFT_06g032800 [Sorghum bicolor] Length = 720 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 530 KNVTLEYLEEAYTTSNWIVRIYKVKPPVNR 441 K++ LEYLEEA+TTSNWIVRIYKVKPP NR Sbjct: 690 KDIKLEYLEEAFTTSNWIVRIYKVKPPKNR 719 >gb|ACR37140.1| unknown [Zea mays] Length = 129 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 530 KNVTLEYLEEAYTTSNWIVRIYKVKPPVNR 441 K++ LEYLEEA+TTSNWIVRIYKVKPP NR Sbjct: 99 KDIKLEYLEEAFTTSNWIVRIYKVKPPKNR 128 >ref|NP_001168720.1| hypothetical protein [Zea mays] gi|223950395|gb|ACN29281.1| unknown [Zea mays] gi|414584798|tpg|DAA35369.1| TPA: hypothetical protein ZEAMMB73_533808 [Zea mays] Length = 719 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 530 KNVTLEYLEEAYTTSNWIVRIYKVKPPVNR 441 K++ LEYLEEA+TTSNWIVRIYKVKPP NR Sbjct: 689 KDIKLEYLEEAFTTSNWIVRIYKVKPPKNR 718 >ref|NP_001131374.1| oligosaccharyl transferase STT3 subunit [Zea mays] gi|195620734|gb|ACG32197.1| oligosaccharyl transferase STT3 subunit [Zea mays] gi|413919949|gb|AFW59881.1| oligosaccharyl transferase STT3 subunit [Zea mays] Length = 720 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 530 KNVTLEYLEEAYTTSNWIVRIYKVKPPVNR 441 K++ LEYLEEA+TTSNWIVRIYKVKPP NR Sbjct: 690 KDIKLEYLEEAFTTSNWIVRIYKVKPPKNR 719 >gb|ACF79760.1| unknown [Zea mays] Length = 176 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 530 KNVTLEYLEEAYTTSNWIVRIYKVKPPVNR 441 K++ LEYLEEA+TTSNWIVRIYKVKPP NR Sbjct: 146 KDIKLEYLEEAFTTSNWIVRIYKVKPPKNR 175 >ref|NP_001054248.1| Os04g0675500 [Oryza sativa Japonica Group] gi|75143872|sp|Q7XQ88.2|STT3B_ORYSJ RecName: Full=Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B; Short=Oligosaccharyl transferase subunit STT3B; Short=STT3-B; AltName: Full=Protein STAUROSPORIN AND TEMPERATURE SENSITIVE 3-LIKE B gi|38344929|emb|CAE03245.2| OSJNBa0018M05.20 [Oryza sativa Japonica Group] gi|90399055|emb|CAJ86104.1| H0103C06.8 [Oryza sativa Indica Group] gi|113565819|dbj|BAF16162.1| Os04g0675500 [Oryza sativa Japonica Group] gi|125550210|gb|EAY96032.1| hypothetical protein OsI_17905 [Oryza sativa Indica Group] gi|125592048|gb|EAZ32398.1| hypothetical protein OsJ_16609 [Oryza sativa Japonica Group] gi|215708677|dbj|BAG93946.1| unnamed protein product [Oryza sativa Japonica Group] Length = 721 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 530 KNVTLEYLEEAYTTSNWIVRIYKVKPPVNR 441 K++ LEYLEEA+TTSNWIVRIYKVKPP NR Sbjct: 691 KDIKLEYLEEAFTTSNWIVRIYKVKPPKNR 720 >gb|EXB95062.1| hypothetical protein L484_003540 [Morus notabilis] Length = 102 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 530 KNVTLEYLEEAYTTSNWIVRIYKVKPPVNR 441 K++ LEYLEEA+TTSNWIVRIYKVKPP NR Sbjct: 72 KDIKLEYLEEAFTTSNWIVRIYKVKPPNNR 101 >ref|XP_004299463.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B-like [Fragaria vesca subsp. vesca] Length = 738 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 530 KNVTLEYLEEAYTTSNWIVRIYKVKPPVNR 441 K++ LEYLEEA+TTSNWIVRIYKVKPP NR Sbjct: 708 KDIKLEYLEEAFTTSNWIVRIYKVKPPNNR 737 >ref|XP_002269119.2| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3-like [Vitis vinifera] Length = 741 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 530 KNVTLEYLEEAYTTSNWIVRIYKVKPPVNR 441 K++ LEYLEEA+TTSNWIVRIYKVKPP NR Sbjct: 711 KDIKLEYLEEAFTTSNWIVRIYKVKPPNNR 740 >emb|CBI35275.3| unnamed protein product [Vitis vinifera] Length = 554 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 530 KNVTLEYLEEAYTTSNWIVRIYKVKPPVNR 441 K++ LEYLEEA+TTSNWIVRIYKVKPP NR Sbjct: 524 KDIKLEYLEEAFTTSNWIVRIYKVKPPNNR 553 >emb|CAN67600.1| hypothetical protein VITISV_012281 [Vitis vinifera] Length = 140 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 530 KNVTLEYLEEAYTTSNWIVRIYKVKPPVNR 441 K++ LEYLEEA+TTSNWIVRIYKVKPP NR Sbjct: 110 KDIKLEYLEEAFTTSNWIVRIYKVKPPNNR 139 >ref|XP_006415033.1| hypothetical protein EUTSA_v10006908mg [Eutrema salsugineum] gi|557092804|gb|ESQ33386.1| hypothetical protein EUTSA_v10006908mg [Eutrema salsugineum] Length = 741 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 530 KNVTLEYLEEAYTTSNWIVRIYKVKPPVNR 441 K++ LE+LEEAYTTSNWIVRIY+VKPP NR Sbjct: 711 KDIKLEHLEEAYTTSNWIVRIYRVKPPTNR 740 >ref|XP_006306856.1| hypothetical protein CARUB_v10008402mg [Capsella rubella] gi|482575567|gb|EOA39754.1| hypothetical protein CARUB_v10008402mg [Capsella rubella] Length = 739 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 530 KNVTLEYLEEAYTTSNWIVRIYKVKPPVNR 441 K++ LE+LEEAYTTSNWIVRIY+VKPP NR Sbjct: 709 KDIKLEHLEEAYTTSNWIVRIYRVKPPTNR 738