BLASTX nr result
ID: Ephedra26_contig00019557
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00019557 (445 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACN40776.1| unknown [Picea sitchensis] 60 2e-07 gb|ABR17563.1| unknown [Picea sitchensis] 60 2e-07 >gb|ACN40776.1| unknown [Picea sitchensis] Length = 484 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = +2 Query: 2 QAKVPEGIEVQYSEACPTRFVIFDQTGSSARMIMHPRLICDYPSWFPKS 148 Q ++ +G+EVQYSEA RF+IFDQTGS R+I+HP L+ ++P+ P S Sbjct: 139 QVQLLDGLEVQYSEAFSKRFIIFDQTGSGVRVIVHPSLVYEFPNLLPDS 187 >gb|ABR17563.1| unknown [Picea sitchensis] Length = 484 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = +2 Query: 2 QAKVPEGIEVQYSEACPTRFVIFDQTGSSARMIMHPRLICDYPSWFPKS 148 Q ++ +G+EVQYSEA RF+IFDQTGS R+I+HP L+ ++P+ P S Sbjct: 139 QVQLLDGLEVQYSEAFSKRFIIFDQTGSGVRVIVHPSLVYEFPNLLPDS 187