BLASTX nr result
ID: Ephedra26_contig00019420
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00019420 (450 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK24902.1| unknown [Picea sitchensis] gi|148906670|gb|ABR164... 60 3e-07 gb|AEW07409.1| hypothetical protein 0_743_01, partial [Pinus rad... 59 9e-07 >gb|ABK24902.1| unknown [Picea sitchensis] gi|148906670|gb|ABR16484.1| unknown [Picea sitchensis] Length = 324 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 448 SRLADMGWKAKISLRDGLIDTYKWYVENYNQ 356 SRLA+MGWK KISLRDGLI TYKWYVENY Q Sbjct: 294 SRLANMGWKPKISLRDGLIGTYKWYVENYLQ 324 >gb|AEW07409.1| hypothetical protein 0_743_01, partial [Pinus radiata] gi|383157406|gb|AFG61045.1| hypothetical protein 0_743_01, partial [Pinus taeda] gi|383157408|gb|AFG61046.1| hypothetical protein 0_743_01, partial [Pinus taeda] gi|383157410|gb|AFG61047.1| hypothetical protein 0_743_01, partial [Pinus taeda] gi|383157412|gb|AFG61048.1| hypothetical protein 0_743_01, partial [Pinus taeda] gi|383157414|gb|AFG61049.1| hypothetical protein 0_743_01, partial [Pinus taeda] gi|383157416|gb|AFG61050.1| hypothetical protein 0_743_01, partial [Pinus taeda] gi|383157418|gb|AFG61051.1| hypothetical protein 0_743_01, partial [Pinus taeda] gi|383157420|gb|AFG61052.1| hypothetical protein 0_743_01, partial [Pinus taeda] gi|383157422|gb|AFG61053.1| hypothetical protein 0_743_01, partial [Pinus taeda] gi|383157424|gb|AFG61054.1| hypothetical protein 0_743_01, partial [Pinus taeda] gi|383157426|gb|AFG61055.1| hypothetical protein 0_743_01, partial [Pinus taeda] gi|383157428|gb|AFG61056.1| hypothetical protein 0_743_01, partial [Pinus taeda] gi|383157430|gb|AFG61057.1| hypothetical protein 0_743_01, partial [Pinus taeda] gi|383157432|gb|AFG61058.1| hypothetical protein 0_743_01, partial [Pinus taeda] gi|383157434|gb|AFG61059.1| hypothetical protein 0_743_01, partial [Pinus taeda] gi|383157436|gb|AFG61060.1| hypothetical protein 0_743_01, partial [Pinus taeda] gi|383157438|gb|AFG61061.1| hypothetical protein 0_743_01, partial [Pinus taeda] gi|383157440|gb|AFG61062.1| hypothetical protein 0_743_01, partial [Pinus taeda] Length = 112 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 448 SRLADMGWKAKISLRDGLIDTYKWYVENYNQ 356 S+LA+MGWK KISLRDGL+ TYKWYVENY Q Sbjct: 82 SKLANMGWKPKISLRDGLVGTYKWYVENYLQ 112