BLASTX nr result
ID: Ephedra26_contig00018115
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00018115 (504 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK24608.1| unknown [Picea sitchensis] 69 5e-10 ref|XP_006488736.1| PREDICTED: rRNA-processing protein fcf2-like... 55 1e-05 ref|XP_006419236.1| hypothetical protein CICLE_v10005920mg [Citr... 55 1e-05 >gb|ABK24608.1| unknown [Picea sitchensis] Length = 347 Score = 69.3 bits (168), Expect = 5e-10 Identities = 36/46 (78%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = +1 Query: 1 EFYS-RLTRKERKPTIADELLSDRDFNQYRKRKHLEIEKQYNPPRK 135 EFYS RLT+KERKPTIADELLSD F QYRKRKHLEIE+ NP K Sbjct: 288 EFYSGRLTKKERKPTIADELLSDSAFQQYRKRKHLEIERVNNPVGK 333 >ref|XP_006488736.1| PREDICTED: rRNA-processing protein fcf2-like [Citrus sinensis] Length = 202 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = +1 Query: 4 FYSRLTRKERKPTIADELLSDRDFNQYRKRKHLEIEKQYNP 126 F SRLT+KERK T+ADELLSD QYRKRK EIE Q P Sbjct: 140 FSSRLTKKERKATLADELLSDPTLGQYRKRKVREIESQNRP 180 >ref|XP_006419236.1| hypothetical protein CICLE_v10005920mg [Citrus clementina] gi|557521109|gb|ESR32476.1| hypothetical protein CICLE_v10005920mg [Citrus clementina] Length = 202 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = +1 Query: 4 FYSRLTRKERKPTIADELLSDRDFNQYRKRKHLEIEKQYNP 126 F SRLT+KERK T+ADELLSD QYRKRK EIE Q P Sbjct: 140 FSSRLTKKERKATLADELLSDPTLGQYRKRKVREIESQNRP 180