BLASTX nr result
ID: Ephedra26_contig00016998
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00016998 (1203 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006850422.1| hypothetical protein AMTR_s00165p00040130 [A... 58 7e-06 >ref|XP_006850422.1| hypothetical protein AMTR_s00165p00040130 [Amborella trichopoda] gi|548854067|gb|ERN12003.1| hypothetical protein AMTR_s00165p00040130 [Amborella trichopoda] Length = 419 Score = 58.2 bits (139), Expect = 7e-06 Identities = 44/120 (36%), Positives = 58/120 (48%), Gaps = 14/120 (11%) Frame = +2 Query: 884 LHQNAQQHPPQSPSSYIPPGWQAAVNPTQE-----RSVSNYDDKNYPPLIAAQGAGMGTQ 1048 L Q QQH + S + QA TQ+ RS S PL + A + Q Sbjct: 240 LQQLKQQHAMKQQSDFTVWARQAKAQQTQQLQGRVRSCSFGARSGGKPLGFSSPAWIPPQ 299 Query: 1049 KNVSEANV---------SGRECGGTGFFLPRRSAKGNDSRRRKTKPACSTVFLPYRVIQA 1201 + ++ + + S RE GGTG FLPRR+ N+ R+ KPACSTV LP RV+QA Sbjct: 300 QQIAGSGMRAVFLNGTGSRRESGGTGVFLPRRAGSPNEMRK---KPACSTVLLPARVVQA 356