BLASTX nr result
ID: Ephedra26_contig00016531
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00016531 (446 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006829918.1| hypothetical protein AMTR_s00073p00138100 [A... 60 3e-07 ref|NP_175141.1| S-ribonuclease binding protein 1 [Arabidopsis t... 56 6e-06 >ref|XP_006829918.1| hypothetical protein AMTR_s00073p00138100 [Amborella trichopoda] gi|548835530|gb|ERM97334.1| hypothetical protein AMTR_s00073p00138100 [Amborella trichopoda] Length = 153 Score = 60.1 bits (144), Expect = 3e-07 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 1/62 (1%) Frame = -3 Query: 186 GSDNEMAWNLLAPRRKS-REQELLENSQISSIDFLQTQRNSLPQSAGTVSTGLRLSLDDE 10 G +++ WNL PR+K +E +L+ENSQISSIDFLQT + G VS GL LSL+D+ Sbjct: 33 GEESDPGWNLWEPRKKKLKELDLIENSQISSIDFLQTHQ------VGAVSVGLGLSLNDK 86 Query: 9 RL 4 RL Sbjct: 87 RL 88 >ref|NP_175141.1| S-ribonuclease binding protein 1 [Arabidopsis thaliana] gi|11692936|gb|AAG40071.1|AF324720_1 F2G19.2 [Arabidopsis thaliana] gi|11993871|gb|AAG42919.1|AF329502_1 putative S-ribonuclease binding protein SBP1 [Arabidopsis thaliana] gi|12321008|gb|AAG50626.1|AC083835_11 S-ribonuclease binding protein SBP1, putative [Arabidopsis thaliana] gi|13194828|gb|AAK15576.1|AF349529_1 putative S-ribonuclease binding protein SBP1 [Arabidopsis thaliana] gi|17979239|gb|AAL49936.1| F2G19.22/F2G19.22 [Arabidopsis thaliana] gi|20147309|gb|AAM10368.1| F2G19.22/F2G19.22 [Arabidopsis thaliana] gi|62320820|dbj|BAD93762.1| S-ribonuclease binding like protein [Arabidopsis thaliana] gi|332194002|gb|AEE32123.1| S-ribonuclease binding protein 1 [Arabidopsis thaliana] Length = 325 Score = 55.8 bits (133), Expect = 6e-06 Identities = 42/90 (46%), Positives = 54/90 (60%), Gaps = 7/90 (7%) Frame = -3 Query: 252 PYIPQFTACNRGQ----QVNGASGLHGSDNEMAWNL-LAPRRKS-REQELLEN-SQISSI 94 PYIP F Q++G+ G +G+D E + L L PRR+ +EQ+ LEN SQISSI Sbjct: 43 PYIPPFHVAGFAPGPVVQIDGSDGGNGADFEWNYGLGLEPRRERIKEQDFLENNSQISSI 102 Query: 93 DFLQTQRNSLPQSAGTVSTGLRLSLDDERL 4 DFLQ A +VSTGL LSLD+ R+ Sbjct: 103 DFLQ---------ARSVSTGLGLSLDNARV 123