BLASTX nr result
ID: Ephedra26_contig00016045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00016045 (617 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310208.2| hypothetical protein POPTR_0007s12540g [Popu... 56 9e-06 >ref|XP_002310208.2| hypothetical protein POPTR_0007s12540g [Populus trichocarpa] gi|550334731|gb|EEE90658.2| hypothetical protein POPTR_0007s12540g [Populus trichocarpa] Length = 667 Score = 55.8 bits (133), Expect = 9e-06 Identities = 28/52 (53%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = +2 Query: 5 AKGPGAVIRKVEVFEACKLEVG-DPSPQIYSKIMKELCTSKGGGWVLKTGDG 157 A+GP A I+K EV A +LE+ +PS Y K+M +LC SKG WVLK+GDG Sbjct: 613 ARGPNANIKKSEVQAAARLELKREPSNSEYIKVMTDLCESKGSAWVLKSGDG 664