BLASTX nr result
ID: Ephedra26_contig00015878
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00015878 (852 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006858919.1| hypothetical protein AMTR_s00068p00051520 [A... 51 3e-10 gb|EMJ22762.1| hypothetical protein PRUPE_ppa014774mg [Prunus pe... 41 3e-06 >ref|XP_006858919.1| hypothetical protein AMTR_s00068p00051520 [Amborella trichopoda] gi|548863031|gb|ERN20386.1| hypothetical protein AMTR_s00068p00051520 [Amborella trichopoda] Length = 859 Score = 50.8 bits (120), Expect(2) = 3e-10 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = +2 Query: 278 DL*IATYKAILASLLMPWCHRPPYLSKALSLFCKGKQESRTR 403 D +A ++A+LASLL P HRPPYLS+ L+LF +GK+E TR Sbjct: 580 DFQLAAFEALLASLLSPCGHRPPYLSQGLALFREGKREGGTR 621 Score = 40.8 bits (94), Expect(2) = 3e-10 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = +3 Query: 405 AEFCSHALLALEPFLHPRSLML 470 AEFC+HALLALEP +HPR+L L Sbjct: 623 AEFCAHALLALEPLIHPRALPL 644 >gb|EMJ22762.1| hypothetical protein PRUPE_ppa014774mg [Prunus persica] Length = 822 Score = 40.8 bits (94), Expect(2) = 3e-06 Identities = 19/39 (48%), Positives = 27/39 (69%) Frame = +2 Query: 287 IATYKAILASLLMPWCHRPPYLSKALSLFCKGKQESRTR 403 +A +A+LAS L C RP YL++ L LF +GKQE+ T+ Sbjct: 533 LAALRALLASFLSSSCVRPTYLAEGLDLFRRGKQETGTK 571 Score = 37.4 bits (85), Expect(2) = 3e-06 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = +3 Query: 405 AEFCSHALLALEPFLHPRSLML 470 AEFC+HALLALE +HPR+L L Sbjct: 573 AEFCAHALLALEVLIHPRALPL 594