BLASTX nr result
ID: Ephedra26_contig00015701
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00015701 (466 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006854627.1| hypothetical protein AMTR_s00030p00173920 [A... 59 7e-07 >ref|XP_006854627.1| hypothetical protein AMTR_s00030p00173920 [Amborella trichopoda] gi|548858313|gb|ERN16094.1| hypothetical protein AMTR_s00030p00173920 [Amborella trichopoda] Length = 709 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 3/44 (6%) Frame = +3 Query: 294 MASYYSGANLQPDAMQTLYLTNPDYTGYADMT---NPGSMLLLN 416 MA+YY G +QPD +QTLYL NP Y GYA+ T NPG+M+LLN Sbjct: 1 MATYYPGTEIQPDNLQTLYLMNPGYVGYAEATPSANPGNMVLLN 44