BLASTX nr result
ID: Ephedra26_contig00015621
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00015621 (594 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006849556.1| hypothetical protein AMTR_s00024p00178520 [A... 63 7e-08 >ref|XP_006849556.1| hypothetical protein AMTR_s00024p00178520 [Amborella trichopoda] gi|548853131|gb|ERN11137.1| hypothetical protein AMTR_s00024p00178520 [Amborella trichopoda] Length = 1257 Score = 62.8 bits (151), Expect = 7e-08 Identities = 31/82 (37%), Positives = 44/82 (53%), Gaps = 1/82 (1%) Frame = +2 Query: 2 SMNSPIAPLHQHQQGYYPCAGSWHPIPNNGLLPYSNPSGYVFPGQTTYGLTPGRIPAFSV 181 +M P+ P H GYY + W P PN GL+P+ PSG +F +YGL R F Sbjct: 1053 TMAMPVFPAHS--MGYYQSSTPWAPSPN-GLVPFIQPSGLLFSSPLSYGLPQSRSSRFCT 1109 Query: 182 PYPSFQPLRPMV-SVSQLPRYP 244 PY + QP P++ +V +P +P Sbjct: 1110 PYGTLQPFNPIINNVGHIPSFP 1131