BLASTX nr result
ID: Ephedra26_contig00015561
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00015561 (526 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFG58409.1| hypothetical protein 2_684_01, partial [Pinus tae... 59 5e-07 gb|AEW08134.1| hypothetical protein 2_684_01, partial [Pinus rad... 59 5e-07 gb|AFB33530.1| hypothetical protein 2_684_01, partial [Pinus cem... 57 2e-06 gb|AEW08135.1| hypothetical protein 2_684_01, partial [Pinus lam... 57 3e-06 >gb|AFG58409.1| hypothetical protein 2_684_01, partial [Pinus taeda] gi|383152597|gb|AFG58410.1| hypothetical protein 2_684_01, partial [Pinus taeda] gi|383152599|gb|AFG58411.1| hypothetical protein 2_684_01, partial [Pinus taeda] gi|383152601|gb|AFG58412.1| hypothetical protein 2_684_01, partial [Pinus taeda] gi|383152603|gb|AFG58413.1| hypothetical protein 2_684_01, partial [Pinus taeda] gi|383152605|gb|AFG58414.1| hypothetical protein 2_684_01, partial [Pinus taeda] gi|383152607|gb|AFG58415.1| hypothetical protein 2_684_01, partial [Pinus taeda] gi|383152609|gb|AFG58416.1| hypothetical protein 2_684_01, partial [Pinus taeda] gi|383152611|gb|AFG58417.1| hypothetical protein 2_684_01, partial [Pinus taeda] gi|383152613|gb|AFG58418.1| hypothetical protein 2_684_01, partial [Pinus taeda] gi|383152615|gb|AFG58419.1| hypothetical protein 2_684_01, partial [Pinus taeda] Length = 162 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/48 (62%), Positives = 36/48 (75%) Frame = -2 Query: 525 VLLELATGKRPLFENENGGGYVADNLIEWVNILASNGRALDAVDPFLL 382 VLLEL TGKRPL +EN G NL+EWVN+L S+GRA +A+DP LL Sbjct: 91 VLLELITGKRPLSVSENSDG----NLVEWVNMLISDGRAAEAIDPLLL 134 >gb|AEW08134.1| hypothetical protein 2_684_01, partial [Pinus radiata] gi|376337964|gb|AFB33538.1| hypothetical protein 2_684_01, partial [Pinus mugo] gi|376337966|gb|AFB33539.1| hypothetical protein 2_684_01, partial [Pinus mugo] gi|376337968|gb|AFB33540.1| hypothetical protein 2_684_01, partial [Pinus mugo] gi|376337970|gb|AFB33541.1| hypothetical protein 2_684_01, partial [Pinus mugo] gi|376337972|gb|AFB33542.1| hypothetical protein 2_684_01, partial [Pinus mugo] gi|376337974|gb|AFB33543.1| hypothetical protein 2_684_01, partial [Pinus mugo] gi|376337976|gb|AFB33544.1| hypothetical protein 2_684_01, partial [Pinus mugo] Length = 162 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/48 (62%), Positives = 36/48 (75%) Frame = -2 Query: 525 VLLELATGKRPLFENENGGGYVADNLIEWVNILASNGRALDAVDPFLL 382 VLLEL TGKRPL +EN G NL+EWVN+L S+GRA +A+DP LL Sbjct: 91 VLLELITGKRPLSVSENSDG----NLVEWVNMLISDGRAAEAIDPLLL 134 >gb|AFB33530.1| hypothetical protein 2_684_01, partial [Pinus cembra] gi|376337950|gb|AFB33531.1| hypothetical protein 2_684_01, partial [Pinus cembra] gi|376337952|gb|AFB33532.1| hypothetical protein 2_684_01, partial [Pinus cembra] gi|376337954|gb|AFB33533.1| hypothetical protein 2_684_01, partial [Pinus cembra] gi|376337956|gb|AFB33534.1| hypothetical protein 2_684_01, partial [Pinus cembra] gi|376337958|gb|AFB33535.1| hypothetical protein 2_684_01, partial [Pinus cembra] gi|376337960|gb|AFB33536.1| hypothetical protein 2_684_01, partial [Pinus cembra] gi|376337962|gb|AFB33537.1| hypothetical protein 2_684_01, partial [Pinus cembra] Length = 162 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/48 (60%), Positives = 34/48 (70%) Frame = -2 Query: 525 VLLELATGKRPLFENENGGGYVADNLIEWVNILASNGRALDAVDPFLL 382 VLLEL TGKRPL EN G NL+EWVN+L S+GR +A+DP LL Sbjct: 91 VLLELITGKRPLSVRENSDG----NLVEWVNMLISSGRGAEAIDPLLL 134 >gb|AEW08135.1| hypothetical protein 2_684_01, partial [Pinus lambertiana] Length = 162 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = -2 Query: 525 VLLELATGKRPLFENENGGGYVADNLIEWVNILASNGRALDAVDPFLL 382 VLLEL TGKRPL EN G NL+EWVN+L +GR +A+DP LL Sbjct: 91 VLLELITGKRPLSVRENSDG----NLVEWVNVLIQSGRGAEAIDPLLL 134