BLASTX nr result
ID: Ephedra26_contig00015480
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00015480 (1025 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK25678.1| unknown [Picea sitchensis] 62 4e-07 ref|XP_004158005.1| PREDICTED: 5'-adenylylsulfate reductase 1, c... 58 5e-06 ref|XP_004145117.1| PREDICTED: 5'-adenylylsulfate reductase 1, c... 58 5e-06 gb|AGT40332.1| APS reductase [Nicotiana attenuata] 58 7e-06 gb|ADN34058.1| adenylyl-sulfate reductase [Cucumis melo subsp. m... 58 7e-06 ref|XP_006348128.1| PREDICTED: 5'-adenylylsulfate reductase 1, c... 57 9e-06 ref|NP_001233829.1| adenylyl-sulfate reductase [Solanum lycopers... 57 9e-06 >gb|ABK25678.1| unknown [Picea sitchensis] Length = 462 Score = 62.0 bits (149), Expect = 4e-07 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 1023 FPTILLFPKKSSKAIKYPSENRDVESLLAFVRTVQ 919 FPTILLFPK SSKAIKYPSE RDV+SLLAF +T+Q Sbjct: 428 FPTILLFPKNSSKAIKYPSEKRDVDSLLAFAKTLQ 462 >ref|XP_004158005.1| PREDICTED: 5'-adenylylsulfate reductase 1, chloroplastic-like [Cucumis sativus] Length = 461 Score = 58.2 bits (139), Expect = 5e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 1023 FPTILLFPKKSSKAIKYPSENRDVESLLAFVRTVQ 919 FPTILLFPK SSKAIKYPSE RDVESL AFV ++ Sbjct: 427 FPTILLFPKHSSKAIKYPSEKRDVESLTAFVNALR 461 >ref|XP_004145117.1| PREDICTED: 5'-adenylylsulfate reductase 1, chloroplastic-like [Cucumis sativus] gi|449471157|ref|XP_004153225.1| PREDICTED: 5'-adenylylsulfate reductase 1, chloroplastic-like [Cucumis sativus] Length = 461 Score = 58.2 bits (139), Expect = 5e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 1023 FPTILLFPKKSSKAIKYPSENRDVESLLAFVRTVQ 919 FPTILLFPK SSKAIKYPSE RDVESL AFV ++ Sbjct: 427 FPTILLFPKHSSKAIKYPSEKRDVESLTAFVNALR 461 >gb|AGT40332.1| APS reductase [Nicotiana attenuata] Length = 460 Score = 57.8 bits (138), Expect = 7e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -3 Query: 1023 FPTILLFPKKSSKAIKYPSENRDVESLLAFVRTVQ 919 FPTILLFPK SSKAIKYP+E RDV+SLLAFV ++ Sbjct: 426 FPTILLFPKHSSKAIKYPTEKRDVDSLLAFVNALR 460 >gb|ADN34058.1| adenylyl-sulfate reductase [Cucumis melo subsp. melo] Length = 465 Score = 57.8 bits (138), Expect = 7e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 1023 FPTILLFPKKSSKAIKYPSENRDVESLLAFVRTVQ 919 FPTIL FPK SSKAIKYPSE RDVESL+AFV ++ Sbjct: 431 FPTILFFPKHSSKAIKYPSEKRDVESLMAFVNALR 465 >ref|XP_006348128.1| PREDICTED: 5'-adenylylsulfate reductase 1, chloroplastic-like [Solanum tuberosum] Length = 460 Score = 57.4 bits (137), Expect = 9e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 1023 FPTILLFPKKSSKAIKYPSENRDVESLLAFVRTVQ 919 FPTIL FPK SSKAIKYPSE RDV+SLLAFV ++ Sbjct: 426 FPTILFFPKHSSKAIKYPSEKRDVDSLLAFVNALR 460 >ref|NP_001233829.1| adenylyl-sulfate reductase [Solanum lycopersicum] gi|51457940|gb|AAU03359.1| adenylyl-sulfate reductase [Solanum lycopersicum] Length = 461 Score = 57.4 bits (137), Expect = 9e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 1023 FPTILLFPKKSSKAIKYPSENRDVESLLAFVRTVQ 919 FPTIL FPK SSKAIKYPSE RDV+SLLAFV ++ Sbjct: 427 FPTILFFPKHSSKAIKYPSEKRDVDSLLAFVNALR 461