BLASTX nr result
ID: Ephedra26_contig00015383
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00015383 (960 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006827282.1| hypothetical protein AMTR_s00010p00263890 [A... 59 2e-06 >ref|XP_006827282.1| hypothetical protein AMTR_s00010p00263890 [Amborella trichopoda] gi|548831711|gb|ERM94519.1| hypothetical protein AMTR_s00010p00263890 [Amborella trichopoda] Length = 89 Score = 59.3 bits (142), Expect = 2e-06 Identities = 38/89 (42%), Positives = 47/89 (52%), Gaps = 11/89 (12%) Frame = +1 Query: 259 GTFGANKMLVLMILVIISTQCVYRCHAIPLSRSIALSE---------NQNQVEMEAEEAF 411 GTF K L+L+I V++ + AIPL+RS+ + NQ E EE Sbjct: 2 GTFN-EKFLILLIFVLLGLSSLVSIKAIPLTRSLQMENHYLQSADDTNQLVTEEIGEEVI 60 Query: 412 HGRMDIESEDYPGSGANRSHEP--GGGSR 492 +GRMDIE DYP SGANR H P GG R Sbjct: 61 NGRMDIECCDYPVSGANRRHTPRQPGGKR 89