BLASTX nr result
ID: Ephedra26_contig00015362
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00015362 (416 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFG45573.1| hypothetical protein 2_5221_01, partial [Pinus ta... 60 4e-07 gb|AFG45564.1| hypothetical protein 2_5221_01, partial [Pinus ta... 60 4e-07 gb|AEW08279.1| hypothetical protein 2_5221_01, partial [Pinus ra... 60 4e-07 >gb|AFG45573.1| hypothetical protein 2_5221_01, partial [Pinus taeda] gi|383129725|gb|AFG45581.1| hypothetical protein 2_5221_01, partial [Pinus taeda] Length = 134 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/75 (40%), Positives = 48/75 (64%), Gaps = 1/75 (1%) Frame = -2 Query: 223 EDQDSQVDYVKEILLSSGLLSKDHSFLGS-SHELRDFSLSPGLFHILEQKRIRKFEYSTK 47 + Q + YVKEILL+SG+L D + + S F ++P LFH+LEQ+R ++ S + Sbjct: 20 QGQTPEYKYVKEILLASGILFIDTDSISTDSFHASGFPINPELFHVLEQRRASQYRISAE 79 Query: 46 HCQDRVNRKLLFDSV 2 + Q++ NR L+FD+V Sbjct: 80 YIQEKHNRHLMFDTV 94 >gb|AFG45564.1| hypothetical protein 2_5221_01, partial [Pinus taeda] gi|383129699|gb|AFG45568.1| hypothetical protein 2_5221_01, partial [Pinus taeda] gi|383129711|gb|AFG45574.1| hypothetical protein 2_5221_01, partial [Pinus taeda] gi|383129719|gb|AFG45578.1| hypothetical protein 2_5221_01, partial [Pinus taeda] Length = 134 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/75 (40%), Positives = 48/75 (64%), Gaps = 1/75 (1%) Frame = -2 Query: 223 EDQDSQVDYVKEILLSSGLLSKDHSFLGS-SHELRDFSLSPGLFHILEQKRIRKFEYSTK 47 + Q + YVKEILL+SG+L D + + S F ++P LFH+LEQ+R ++ S + Sbjct: 20 QGQTPEYKYVKEILLASGILFIDTDSISTDSFHASGFPINPELFHVLEQRRASQYRISAE 79 Query: 46 HCQDRVNRKLLFDSV 2 + Q++ NR L+FD+V Sbjct: 80 YIQEKHNRHLMFDTV 94 >gb|AEW08279.1| hypothetical protein 2_5221_01, partial [Pinus radiata] gi|383129693|gb|AFG45565.1| hypothetical protein 2_5221_01, partial [Pinus taeda] gi|383129695|gb|AFG45566.1| hypothetical protein 2_5221_01, partial [Pinus taeda] gi|383129697|gb|AFG45567.1| hypothetical protein 2_5221_01, partial [Pinus taeda] gi|383129701|gb|AFG45569.1| hypothetical protein 2_5221_01, partial [Pinus taeda] gi|383129703|gb|AFG45570.1| hypothetical protein 2_5221_01, partial [Pinus taeda] gi|383129705|gb|AFG45571.1| hypothetical protein 2_5221_01, partial [Pinus taeda] gi|383129707|gb|AFG45572.1| hypothetical protein 2_5221_01, partial [Pinus taeda] gi|383129713|gb|AFG45575.1| hypothetical protein 2_5221_01, partial [Pinus taeda] gi|383129715|gb|AFG45576.1| hypothetical protein 2_5221_01, partial [Pinus taeda] gi|383129717|gb|AFG45577.1| hypothetical protein 2_5221_01, partial [Pinus taeda] gi|383129721|gb|AFG45579.1| hypothetical protein 2_5221_01, partial [Pinus taeda] gi|383129723|gb|AFG45580.1| hypothetical protein 2_5221_01, partial [Pinus taeda] Length = 134 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/75 (40%), Positives = 48/75 (64%), Gaps = 1/75 (1%) Frame = -2 Query: 223 EDQDSQVDYVKEILLSSGLLSKDHSFLGS-SHELRDFSLSPGLFHILEQKRIRKFEYSTK 47 + Q + YVKEILL+SG+L D + + S F ++P LFH+LEQ+R ++ S + Sbjct: 20 QGQTPEYKYVKEILLASGILFIDTDSISTDSFHASGFPINPELFHVLEQRRASQYRISAE 79 Query: 46 HCQDRVNRKLLFDSV 2 + Q++ NR L+FD+V Sbjct: 80 YIQEKHNRHLMFDTV 94