BLASTX nr result
ID: Ephedra26_contig00014880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00014880 (785 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK26520.1| unknown [Picea sitchensis] 61 5e-07 ref|XP_004288534.1| PREDICTED: thioredoxin-like 1-1, chloroplast... 60 7e-07 emb|CBI29919.3| unnamed protein product [Vitis vinifera] 60 7e-07 ref|XP_002282457.1| PREDICTED: thioredoxin-like 1-1, chloroplast... 60 7e-07 emb|CAN64807.1| hypothetical protein VITISV_007145 [Vitis vinifera] 60 7e-07 ref|XP_004493141.1| PREDICTED: thioredoxin-like 1-1, chloroplast... 60 9e-07 ref|XP_002325404.1| thioredoxin-like 7 family protein [Populus t... 60 9e-07 ref|NP_200952.1| atypical CYS HIS rich thioredoxin 5 [Arabidops... 60 1e-06 ref|XP_006280989.1| hypothetical protein CARUB_v10026990mg [Caps... 60 1e-06 ref|XP_002889703.1| thioredoxin family protein [Arabidopsis lyra... 60 1e-06 gb|AFD98846.1| chloroplast Trx [Gossypium hirsutum] 59 1e-06 ref|XP_006364586.1| PREDICTED: thioredoxin-like 1-2, chloroplast... 59 2e-06 gb|ESW33954.1| hypothetical protein PHAVU_001G112200g [Phaseolus... 59 2e-06 gb|ESW33918.1| hypothetical protein PHAVU_001G109200g [Phaseolus... 59 2e-06 ref|XP_004236024.1| PREDICTED: thioredoxin-like 1-2, chloroplast... 59 2e-06 tpg|DAA45143.1| TPA: putative thioredoxin superfamily protein [Z... 59 2e-06 ref|XP_003624602.1| Thioredoxin-like protein [Medicago truncatul... 59 2e-06 ref|NP_001266702.1| thioredoxin-like 1 [Zea mays] gi|195650865|g... 59 2e-06 ref|NP_001130053.1| putative thioredoxin superfamily protein [Ze... 59 2e-06 ref|XP_003624601.1| Thioredoxin-like protein [Medicago truncatul... 59 2e-06 >gb|ABK26520.1| unknown [Picea sitchensis] Length = 304 Score = 60.8 bits (146), Expect = 5e-07 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = +1 Query: 1 ELVGALLNAGDQLVVLNYFSPGCGACRSVHPKIC 102 ELV +LL AGD+LVV+++++PGCGACRSVHPKIC Sbjct: 121 ELVDSLLTAGDKLVVVDFYAPGCGACRSVHPKIC 154 >ref|XP_004288534.1| PREDICTED: thioredoxin-like 1-1, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 276 Score = 60.5 bits (145), Expect = 7e-07 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = +1 Query: 1 ELVGALLNAGDQLVVLNYFSPGCGACRSVHPKIC 102 +LV +LLNAGD+LVVL++FSPGCG C+++HPKIC Sbjct: 96 DLVDSLLNAGDKLVVLDFFSPGCGGCKALHPKIC 129 >emb|CBI29919.3| unnamed protein product [Vitis vinifera] Length = 309 Score = 60.5 bits (145), Expect = 7e-07 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = +1 Query: 1 ELVGALLNAGDQLVVLNYFSPGCGACRSVHPKIC 102 +LV +LLNAGD+LVV+++FSPGCG CR++HPKIC Sbjct: 120 DLVDSLLNAGDKLVVVDFFSPGCGGCRALHPKIC 153 >ref|XP_002282457.1| PREDICTED: thioredoxin-like 1-1, chloroplastic-like [Vitis vinifera] Length = 311 Score = 60.5 bits (145), Expect = 7e-07 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = +1 Query: 1 ELVGALLNAGDQLVVLNYFSPGCGACRSVHPKIC 102 +LV +LLNAGD+LVV+++FSPGCG CR++HPKIC Sbjct: 122 DLVDSLLNAGDKLVVVDFFSPGCGGCRALHPKIC 155 >emb|CAN64807.1| hypothetical protein VITISV_007145 [Vitis vinifera] Length = 311 Score = 60.5 bits (145), Expect = 7e-07 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = +1 Query: 1 ELVGALLNAGDQLVVLNYFSPGCGACRSVHPKIC 102 +LV +LLNAGD+LVV+++FSPGCG CR++HPKIC Sbjct: 122 DLVDSLLNAGDKLVVVDFFSPGCGGCRALHPKIC 155 >ref|XP_004493141.1| PREDICTED: thioredoxin-like 1-1, chloroplastic-like [Cicer arietinum] Length = 297 Score = 60.1 bits (144), Expect = 9e-07 Identities = 23/34 (67%), Positives = 32/34 (94%) Frame = +1 Query: 1 ELVGALLNAGDQLVVLNYFSPGCGACRSVHPKIC 102 +LV +LLNAGD+LV++++FSPGCG CR++HPKIC Sbjct: 117 DLVDSLLNAGDKLVIVDFFSPGCGGCRALHPKIC 150 >ref|XP_002325404.1| thioredoxin-like 7 family protein [Populus trichocarpa] gi|222862279|gb|EEE99785.1| thioredoxin-like 7 family protein [Populus trichocarpa] Length = 295 Score = 60.1 bits (144), Expect = 9e-07 Identities = 23/34 (67%), Positives = 32/34 (94%) Frame = +1 Query: 1 ELVGALLNAGDQLVVLNYFSPGCGACRSVHPKIC 102 +LV +L+NAGDQLVV+++FSPGCG C+++HPKIC Sbjct: 113 DLVDSLMNAGDQLVVVDFFSPGCGGCKALHPKIC 146 >ref|NP_200952.1| atypical CYS HIS rich thioredoxin 5 [Arabidopsis thaliana] gi|51702163|sp|Q9XFI1.1|TRL12_ARATH RecName: Full=Thioredoxin-like 1-2, chloroplastic; AltName: Full=Atypical cysteine/histidine-rich thioredoxin 5; Short=AtACHT5; AltName: Full=Lilium-type thioredoxin 1-2; Flags: Precursor gi|4973260|gb|AAD35007.1|AF144389_1 thioredoxin-like 3 [Arabidopsis thaliana] gi|9757866|dbj|BAB08500.1| thioredoxin-like 3 [Arabidopsis thaliana] gi|87116568|gb|ABD19648.1| At5g61440 [Arabidopsis thaliana] gi|110737981|dbj|BAF00926.1| thioredoxin-like 3 [Arabidopsis thaliana] gi|332010086|gb|AED97469.1| atypical CYS HIS rich thioredoxin 5 [Arabidopsis thaliana] Length = 245 Score = 59.7 bits (143), Expect = 1e-06 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +1 Query: 4 LVGALLNAGDQLVVLNYFSPGCGACRSVHPKIC 102 LV +LLNAGD+LVVL+++SPGCG C+S+HPKIC Sbjct: 96 LVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKIC 128 >ref|XP_006280989.1| hypothetical protein CARUB_v10026990mg [Capsella rubella] gi|482549693|gb|EOA13887.1| hypothetical protein CARUB_v10026990mg [Capsella rubella] Length = 252 Score = 59.7 bits (143), Expect = 1e-06 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +1 Query: 4 LVGALLNAGDQLVVLNYFSPGCGACRSVHPKIC 102 LV +LLNAGD+LVVL+++SPGCG C+S+HPKIC Sbjct: 101 LVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKIC 133 >ref|XP_002889703.1| thioredoxin family protein [Arabidopsis lyrata subsp. lyrata] gi|297335545|gb|EFH65962.1| thioredoxin family protein [Arabidopsis lyrata subsp. lyrata] Length = 276 Score = 59.7 bits (143), Expect = 1e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +1 Query: 1 ELVGALLNAGDQLVVLNYFSPGCGACRSVHPKIC 102 ELV +L NAGD+LVVL++FSPGCG C+++HPKIC Sbjct: 108 ELVDSLTNAGDKLVVLDFFSPGCGGCKALHPKIC 141 >gb|AFD98846.1| chloroplast Trx [Gossypium hirsutum] Length = 287 Score = 59.3 bits (142), Expect = 1e-06 Identities = 23/34 (67%), Positives = 32/34 (94%) Frame = +1 Query: 1 ELVGALLNAGDQLVVLNYFSPGCGACRSVHPKIC 102 +LV +LLNAGD+LVV+++FSPGCG C+++HPKIC Sbjct: 112 DLVDSLLNAGDKLVVVDFFSPGCGGCKALHPKIC 145 >ref|XP_006364586.1| PREDICTED: thioredoxin-like 1-2, chloroplastic-like [Solanum tuberosum] Length = 248 Score = 58.9 bits (141), Expect = 2e-06 Identities = 22/34 (64%), Positives = 31/34 (91%) Frame = +1 Query: 1 ELVGALLNAGDQLVVLNYFSPGCGACRSVHPKIC 102 EL +LLNAGD+LV+++++SPGCG CR++HPKIC Sbjct: 86 ELADSLLNAGDRLVIIDFYSPGCGGCRTLHPKIC 119 >gb|ESW33954.1| hypothetical protein PHAVU_001G112200g [Phaseolus vulgaris] Length = 292 Score = 58.9 bits (141), Expect = 2e-06 Identities = 23/34 (67%), Positives = 32/34 (94%) Frame = +1 Query: 1 ELVGALLNAGDQLVVLNYFSPGCGACRSVHPKIC 102 +LV +LLNAGD+LVV+++FSPGCG C+++HPKIC Sbjct: 116 DLVESLLNAGDKLVVVDFFSPGCGGCKALHPKIC 149 >gb|ESW33918.1| hypothetical protein PHAVU_001G109200g [Phaseolus vulgaris] Length = 291 Score = 58.9 bits (141), Expect = 2e-06 Identities = 23/34 (67%), Positives = 32/34 (94%) Frame = +1 Query: 1 ELVGALLNAGDQLVVLNYFSPGCGACRSVHPKIC 102 +LV +LLNAGD+LVV+++FSPGCG C+++HPKIC Sbjct: 116 DLVESLLNAGDKLVVVDFFSPGCGGCKALHPKIC 149 >ref|XP_004236024.1| PREDICTED: thioredoxin-like 1-2, chloroplastic-like [Solanum lycopersicum] Length = 244 Score = 58.9 bits (141), Expect = 2e-06 Identities = 22/34 (64%), Positives = 31/34 (91%) Frame = +1 Query: 1 ELVGALLNAGDQLVVLNYFSPGCGACRSVHPKIC 102 EL +LLNAGD+LV+++++SPGCG CR++HPKIC Sbjct: 86 ELADSLLNAGDRLVIIDFYSPGCGGCRTLHPKIC 119 >tpg|DAA45143.1| TPA: putative thioredoxin superfamily protein [Zea mays] Length = 289 Score = 58.9 bits (141), Expect = 2e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +1 Query: 1 ELVGALLNAGDQLVVLNYFSPGCGACRSVHPKIC 102 +LV AL NAGD+LVV+++FSPGCG CR+ HPKIC Sbjct: 106 DLVDALTNAGDRLVVVDFFSPGCGGCRAFHPKIC 139 >ref|XP_003624602.1| Thioredoxin-like protein [Medicago truncatula] gi|355499617|gb|AES80820.1| Thioredoxin-like protein [Medicago truncatula] Length = 220 Score = 58.9 bits (141), Expect = 2e-06 Identities = 22/34 (64%), Positives = 32/34 (94%) Frame = +1 Query: 1 ELVGALLNAGDQLVVLNYFSPGCGACRSVHPKIC 102 +LV +LLNAGD+LV++++FSPGCG C+++HPKIC Sbjct: 117 DLVDSLLNAGDKLVIVDFFSPGCGGCKALHPKIC 150 >ref|NP_001266702.1| thioredoxin-like 1 [Zea mays] gi|195650865|gb|ACG44900.1| thioredoxin-like 1 [Zea mays] Length = 276 Score = 58.9 bits (141), Expect = 2e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +1 Query: 1 ELVGALLNAGDQLVVLNYFSPGCGACRSVHPKIC 102 +LV AL NAGD+LVV+++FSPGCG CR+ HPKIC Sbjct: 101 DLVDALTNAGDRLVVVDFFSPGCGGCRAFHPKIC 134 >ref|NP_001130053.1| putative thioredoxin superfamily protein [Zea mays] gi|194688174|gb|ACF78171.1| unknown [Zea mays] gi|414866587|tpg|DAA45144.1| TPA: putative thioredoxin superfamily protein [Zea mays] Length = 284 Score = 58.9 bits (141), Expect = 2e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +1 Query: 1 ELVGALLNAGDQLVVLNYFSPGCGACRSVHPKIC 102 +LV AL NAGD+LVV+++FSPGCG CR+ HPKIC Sbjct: 101 DLVDALTNAGDRLVVVDFFSPGCGGCRAFHPKIC 134 >ref|XP_003624601.1| Thioredoxin-like protein [Medicago truncatula] gi|124365591|gb|ABN09825.1| Thioredoxin domain 2; Thioredoxin fold [Medicago truncatula] gi|355499616|gb|AES80819.1| Thioredoxin-like protein [Medicago truncatula] gi|388494216|gb|AFK35174.1| unknown [Medicago truncatula] Length = 286 Score = 58.9 bits (141), Expect = 2e-06 Identities = 22/34 (64%), Positives = 32/34 (94%) Frame = +1 Query: 1 ELVGALLNAGDQLVVLNYFSPGCGACRSVHPKIC 102 +LV +LLNAGD+LV++++FSPGCG C+++HPKIC Sbjct: 117 DLVDSLLNAGDKLVIVDFFSPGCGGCKALHPKIC 150