BLASTX nr result
ID: Ephedra26_contig00014695
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00014695 (459 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACE86396.1| rp3-like disease resistance protein [Sorghum bico... 55 1e-05 gb|ACB72454.1| Pc protein A [Sorghum bicolor] 55 1e-05 >gb|ACE86396.1| rp3-like disease resistance protein [Sorghum bicolor] Length = 1157 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 1/71 (1%) Frame = -1 Query: 234 SSPPLRILSLYECNDEFLGN-LEKLVSLEHLKLKHCRSLRELPFGISHLPRLRTIRLDRC 58 S P LR L+L E L + + +LE + LK C LRELP GI++L RL + ++RC Sbjct: 703 SCPTLRTLNLSETKVTMLPQWVTSIDTLECIDLKGCNELRELPKGIANLKRLTVLNIERC 762 Query: 57 DQLQCLPEDIG 25 +L CLP +G Sbjct: 763 SKLCCLPSGLG 773 >gb|ACB72454.1| Pc protein A [Sorghum bicolor] Length = 1277 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 1/71 (1%) Frame = -1 Query: 234 SSPPLRILSLYECNDEFLGN-LEKLVSLEHLKLKHCRSLRELPFGISHLPRLRTIRLDRC 58 S P LR L+L E L + + +LE + LK C LRELP GI++L RL + ++RC Sbjct: 757 SCPTLRTLNLSETKVTMLPQWVTSIDTLECIDLKGCNELRELPKGIANLKRLTVLNIERC 816 Query: 57 DQLQCLPEDIG 25 +L CLP +G Sbjct: 817 SKLCCLPSGLG 827