BLASTX nr result
ID: Ephedra26_contig00014663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00014663 (485 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK25211.1| unknown [Picea sitchensis] 89 6e-16 ref|XP_002327284.1| predicted protein [Populus trichocarpa] gi|5... 77 3e-12 ref|XP_003538557.2| PREDICTED: F-box/kelch-repeat protein At1g67... 73 4e-11 ref|XP_002311715.1| kelch repeat-containing F-box family protein... 72 6e-11 ref|XP_006376126.1| hypothetical protein POPTR_0013s10040g [Popu... 72 8e-11 gb|EXC06147.1| F-box/kelch-repeat protein [Morus notabilis] 72 1e-10 ref|XP_002514931.1| Protein AFR, putative [Ricinus communis] gi|... 72 1e-10 ref|XP_002314539.1| hypothetical protein POPTR_0010s06910g [Popu... 71 2e-10 gb|EPS58108.1| hypothetical protein M569_16708, partial [Genlise... 70 2e-10 ref|XP_006601756.1| PREDICTED: uncharacterized protein LOC100500... 70 4e-10 ref|XP_006585113.1| PREDICTED: F-box/kelch-repeat protein At1g67... 69 5e-10 gb|EOX99905.1| AFR, putative [Theobroma cacao] 69 5e-10 ref|XP_003531188.1| PREDICTED: F-box/kelch-repeat protein At1g67... 69 5e-10 ref|XP_004504451.1| PREDICTED: F-box/kelch-repeat protein At1g67... 68 1e-09 ref|XP_004502305.1| PREDICTED: F-box/kelch-repeat protein At1g67... 68 1e-09 ref|XP_006302407.1| hypothetical protein CARUB_v10020480mg [Caps... 68 1e-09 gb|AAC18788.1| Contains similarity to beta scruin gb|Z47541 from... 68 1e-09 ref|NP_176915.1| F-box/kelch-repeat protein [Arabidopsis thalian... 68 1e-09 ref|XP_002887123.1| kelch repeat-containing F-box family protein... 68 1e-09 ref|XP_002272745.1| PREDICTED: F-box/kelch-repeat protein At1g67... 67 3e-09 >gb|ABK25211.1| unknown [Picea sitchensis] Length = 386 Score = 89.0 bits (219), Expect = 6e-16 Identities = 45/93 (48%), Positives = 58/93 (62%), Gaps = 4/93 (4%) Frame = +3 Query: 219 MLEVVRACESFNPNSRSHVTG-FCRNFLGQK---THTHKLQNAYPPDLIPGLTDDIAKHC 386 M++V CE R H TG + + + Q+ T+ N L+PGL DD+AKHC Sbjct: 1 MMQVATTCEVLKTKPRIHATGIYISSSMRQQSLPTNAMPCNNEPESALLPGLPDDVAKHC 60 Query: 387 LALVPRKHLQSMGSVCKLWRSFIQSNEFYVIRK 485 LALVPR H QS+GSVCK WR F+QS EF+V+RK Sbjct: 61 LALVPRIHFQSLGSVCKPWRKFLQSKEFHVVRK 93 >ref|XP_002327284.1| predicted protein [Populus trichocarpa] gi|566200405|ref|XP_006376125.1| hypothetical protein POPTR_0013s10040g [Populus trichocarpa] gi|550325394|gb|ERP53922.1| hypothetical protein POPTR_0013s10040g [Populus trichocarpa] Length = 381 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/89 (41%), Positives = 53/89 (59%) Frame = +3 Query: 219 MLEVVRACESFNPNSRSHVTGFCRNFLGQKTHTHKLQNAYPPDLIPGLTDDIAKHCLALV 398 ML +V + F + + T ++F + ++ N ++PGL DD+AK+CLALV Sbjct: 1 MLGIVSGKKRFTEANMTFSTLITQDFKSKPRLASQIPNDIDSPILPGLPDDVAKYCLALV 60 Query: 399 PRKHLQSMGSVCKLWRSFIQSNEFYVIRK 485 PR H +MGSVCK WRSF++S E IRK Sbjct: 61 PRSHFPTMGSVCKKWRSFLKSKELITIRK 89 >ref|XP_003538557.2| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Glycine max] Length = 385 Score = 72.8 bits (177), Expect = 4e-11 Identities = 35/69 (50%), Positives = 46/69 (66%), Gaps = 3/69 (4%) Frame = +3 Query: 288 RNFLGQKTHT---HKLQNAYPPDLIPGLTDDIAKHCLALVPRKHLQSMGSVCKLWRSFIQ 458 ++ L Q H L Y P ++PGL DD+A++CLALVPR + +MG VCK+WRSFIQ Sbjct: 26 KSTLSQNNHCLFPEALNKDYSP-ILPGLPDDVAEYCLALVPRSNFPAMGGVCKIWRSFIQ 84 Query: 459 SNEFYVIRK 485 S EF +RK Sbjct: 85 SKEFATVRK 93 >ref|XP_002311715.1| kelch repeat-containing F-box family protein [Populus trichocarpa] gi|222851535|gb|EEE89082.1| kelch repeat-containing F-box family protein [Populus trichocarpa] Length = 371 Score = 72.4 bits (176), Expect = 6e-11 Identities = 29/46 (63%), Positives = 40/46 (86%) Frame = +3 Query: 348 LIPGLTDDIAKHCLALVPRKHLQSMGSVCKLWRSFIQSNEFYVIRK 485 ++PGL DD+AK+CLALVPR++L +MG+VCK WRSF++S EF +RK Sbjct: 34 IVPGLPDDVAKYCLALVPRRYLPAMGAVCKKWRSFLKSQEFITVRK 79 >ref|XP_006376126.1| hypothetical protein POPTR_0013s10040g [Populus trichocarpa] gi|550325395|gb|ERP53923.1| hypothetical protein POPTR_0013s10040g [Populus trichocarpa] Length = 431 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/55 (56%), Positives = 40/55 (72%) Frame = +3 Query: 321 KLQNAYPPDLIPGLTDDIAKHCLALVPRKHLQSMGSVCKLWRSFIQSNEFYVIRK 485 ++ N ++PGL DD+AK+CLALVPR H +MGSVCK WRSF++S E IRK Sbjct: 85 QIPNDIDSPILPGLPDDVAKYCLALVPRSHFPTMGSVCKKWRSFLKSKELITIRK 139 >gb|EXC06147.1| F-box/kelch-repeat protein [Morus notabilis] Length = 370 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/55 (58%), Positives = 40/55 (72%) Frame = +3 Query: 321 KLQNAYPPDLIPGLTDDIAKHCLALVPRKHLQSMGSVCKLWRSFIQSNEFYVIRK 485 +L + Y ++PGL DD+AK CLALVPR + +MG VCK WRSFIQS EF +RK Sbjct: 24 QLPDDYNSPILPGLPDDVAKLCLALVPRSNFPAMGGVCKKWRSFIQSKEFITVRK 78 >ref|XP_002514931.1| Protein AFR, putative [Ricinus communis] gi|223545982|gb|EEF47485.1| Protein AFR, putative [Ricinus communis] Length = 391 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = +3 Query: 348 LIPGLTDDIAKHCLALVPRKHLQSMGSVCKLWRSFIQSNEFYVIRK 485 ++PGL DD+AK+CLALVPR + SMG+VCK WRSF++S EF V+RK Sbjct: 55 ILPGLPDDVAKYCLALVPRPYFPSMGAVCKKWRSFMKSKEFLVVRK 100 >ref|XP_002314539.1| hypothetical protein POPTR_0010s06910g [Populus trichocarpa] gi|222863579|gb|EEF00710.1| hypothetical protein POPTR_0010s06910g [Populus trichocarpa] Length = 385 Score = 70.9 bits (172), Expect = 2e-10 Identities = 28/46 (60%), Positives = 40/46 (86%) Frame = +3 Query: 348 LIPGLTDDIAKHCLALVPRKHLQSMGSVCKLWRSFIQSNEFYVIRK 485 ++PGL DD+AK+CLALVPR++L +MG+VCK WRSF+++ EF +RK Sbjct: 48 ILPGLPDDVAKYCLALVPRRYLPAMGAVCKKWRSFLKTKEFITVRK 93 >gb|EPS58108.1| hypothetical protein M569_16708, partial [Genlisea aurea] Length = 269 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = +3 Query: 336 YPPDLIPGLTDDIAKHCLALVPRKHLQSMGSVCKLWRSFIQSNEFYVIRK 485 Y P L+PGL DD++KHCLALVPR HL MG+V K WRSFI+S EF +R+ Sbjct: 31 YSP-LLPGLPDDVSKHCLALVPRSHLPVMGAVSKRWRSFIKSGEFVTVRR 79 >ref|XP_006601756.1| PREDICTED: uncharacterized protein LOC100500176 isoform X1 [Glycine max] Length = 385 Score = 69.7 bits (169), Expect = 4e-10 Identities = 35/69 (50%), Positives = 45/69 (65%), Gaps = 3/69 (4%) Frame = +3 Query: 288 RNFLGQKTHT---HKLQNAYPPDLIPGLTDDIAKHCLALVPRKHLQSMGSVCKLWRSFIQ 458 ++ L Q H L Y P ++PGL DD+A++CLALVPR + +MG VCK WRSFIQ Sbjct: 26 KSTLSQSNHCLFPEALNKDYSP-ILPGLPDDVAEYCLALVPRSNFPAMGVVCKGWRSFIQ 84 Query: 459 SNEFYVIRK 485 S EF +RK Sbjct: 85 SKEFTTVRK 93 >ref|XP_006585113.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like isoform X3 [Glycine max] Length = 341 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = +3 Query: 348 LIPGLTDDIAKHCLALVPRKHLQSMGSVCKLWRSFIQSNEFYVIRK 485 ++PGL DD++KHCLALVPR + +MG VCK WR FI+S EF +RK Sbjct: 51 ILPGLPDDVSKHCLALVPRSNFPAMGGVCKRWRGFIRSKEFITVRK 96 >gb|EOX99905.1| AFR, putative [Theobroma cacao] Length = 402 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = +3 Query: 348 LIPGLTDDIAKHCLALVPRKHLQSMGSVCKLWRSFIQSNEFYVIRK 485 L+PGL DD+AK+CLALVPR +MG VCK WRSFIQS EF+ R+ Sbjct: 65 LLPGLPDDVAKYCLALVPRSSFPAMGGVCKRWRSFIQSKEFFTERR 110 >ref|XP_003531188.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like isoform X1 [Glycine max] gi|571470789|ref|XP_006585112.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like isoform X2 [Glycine max] Length = 388 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = +3 Query: 348 LIPGLTDDIAKHCLALVPRKHLQSMGSVCKLWRSFIQSNEFYVIRK 485 ++PGL DD++KHCLALVPR + +MG VCK WR FI+S EF +RK Sbjct: 51 ILPGLPDDVSKHCLALVPRSNFPAMGGVCKRWRGFIRSKEFITVRK 96 >ref|XP_004504451.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like isoform X1 [Cicer arietinum] gi|502141116|ref|XP_004504452.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like isoform X2 [Cicer arietinum] gi|502141118|ref|XP_004504453.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like isoform X3 [Cicer arietinum] Length = 377 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/56 (55%), Positives = 40/56 (71%) Frame = +3 Query: 318 HKLQNAYPPDLIPGLTDDIAKHCLALVPRKHLQSMGSVCKLWRSFIQSNEFYVIRK 485 HK+ + P ++PGL DD++K+CLALVPR +MGSVCK WR FIQ EF +RK Sbjct: 32 HKVVDDSP--ILPGLLDDVSKYCLALVPRSDSPAMGSVCKRWRQFIQGEEFITVRK 85 >ref|XP_004502305.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Cicer arietinum] Length = 385 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = +3 Query: 348 LIPGLTDDIAKHCLALVPRKHLQSMGSVCKLWRSFIQSNEFYVIRK 485 ++PGL DD+AK+CLALVPR + +MG VCK WR F+QS EF ++RK Sbjct: 48 ILPGLPDDVAKYCLALVPRSNFPAMGGVCKRWRLFMQSKEFVMVRK 93 >ref|XP_006302407.1| hypothetical protein CARUB_v10020480mg [Capsella rubella] gi|565489537|ref|XP_006302408.1| hypothetical protein CARUB_v10020480mg [Capsella rubella] gi|482571117|gb|EOA35305.1| hypothetical protein CARUB_v10020480mg [Capsella rubella] gi|482571118|gb|EOA35306.1| hypothetical protein CARUB_v10020480mg [Capsella rubella] Length = 376 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/53 (58%), Positives = 36/53 (67%) Frame = +3 Query: 327 QNAYPPDLIPGLTDDIAKHCLALVPRKHLQSMGSVCKLWRSFIQSNEFYVIRK 485 +N LIPGL DD+AK CLALVPR SMGSVCK WR +QS EF +R+ Sbjct: 32 ENFMDDPLIPGLPDDVAKQCLALVPRARFPSMGSVCKKWRFVVQSKEFITVRR 84 >gb|AAC18788.1| Contains similarity to beta scruin gb|Z47541 from Limulus polyphemus. ESTs gb|T04493 and gb|AA585955 come from this gene [Arabidopsis thaliana] Length = 433 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/53 (58%), Positives = 36/53 (67%) Frame = +3 Query: 327 QNAYPPDLIPGLTDDIAKHCLALVPRKHLQSMGSVCKLWRSFIQSNEFYVIRK 485 +N LIPGL DD+AK CLALVPR SMGSVCK WR +QS EF +R+ Sbjct: 89 ENFMDDPLIPGLPDDVAKQCLALVPRARFPSMGSVCKKWRFVVQSKEFITVRR 141 >ref|NP_176915.1| F-box/kelch-repeat protein [Arabidopsis thaliana] gi|145326676|ref|NP_001077785.1| F-box/kelch-repeat protein [Arabidopsis thaliana] gi|75169883|sp|Q9CAG8.1|FBK28_ARATH RecName: Full=F-box/kelch-repeat protein At1g67480 gi|12324672|gb|AAG52295.1|AC011020_2 unknown protein [Arabidopsis thaliana] gi|110737876|dbj|BAF00876.1| hypothetical protein [Arabidopsis thaliana] gi|119935813|gb|ABM06000.1| At1g67480 [Arabidopsis thaliana] gi|332196530|gb|AEE34651.1| F-box/kelch-repeat protein [Arabidopsis thaliana] gi|332196531|gb|AEE34652.1| F-box/kelch-repeat protein [Arabidopsis thaliana] Length = 376 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/53 (58%), Positives = 36/53 (67%) Frame = +3 Query: 327 QNAYPPDLIPGLTDDIAKHCLALVPRKHLQSMGSVCKLWRSFIQSNEFYVIRK 485 +N LIPGL DD+AK CLALVPR SMGSVCK WR +QS EF +R+ Sbjct: 32 ENFMDDPLIPGLPDDVAKQCLALVPRARFPSMGSVCKKWRFVVQSKEFITVRR 84 >ref|XP_002887123.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297332964|gb|EFH63382.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata subsp. lyrata] Length = 376 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/53 (58%), Positives = 36/53 (67%) Frame = +3 Query: 327 QNAYPPDLIPGLTDDIAKHCLALVPRKHLQSMGSVCKLWRSFIQSNEFYVIRK 485 +N LIPGL DD+AK CLALVPR SMGSVCK WR +QS EF +R+ Sbjct: 32 ENFMDDPLIPGLPDDVAKQCLALVPRARFPSMGSVCKKWRFVVQSKEFITVRR 84 >ref|XP_002272745.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Vitis vinifera] gi|297738424|emb|CBI27625.3| unnamed protein product [Vitis vinifera] Length = 385 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/52 (57%), Positives = 40/52 (76%) Frame = +3 Query: 330 NAYPPDLIPGLTDDIAKHCLALVPRKHLQSMGSVCKLWRSFIQSNEFYVIRK 485 ++Y P ++PGL DD+AK+CLALVPR + +MG V K WRSFI+S EF +RK Sbjct: 43 DSYGP-ILPGLPDDVAKYCLALVPRSNFPAMGGVSKKWRSFIRSKEFITVRK 93