BLASTX nr result
ID: Ephedra26_contig00014175
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00014175 (544 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004507897.1| PREDICTED: protein CHLOROPLAST IMPORT APPARA... 89 5e-16 ref|XP_003549301.1| PREDICTED: protein CHLOROPLAST IMPORT APPARA... 89 5e-16 ref|XP_003543009.1| PREDICTED: protein CHLOROPLAST IMPORT APPARA... 89 5e-16 gb|EXC31212.1| Protein CHLOROPLAST IMPORT APPARATUS 2 [Morus not... 87 2e-15 gb|EOY32042.1| Chloroplast import apparatus 2, putative isoform ... 87 2e-15 emb|CBI40095.3| unnamed protein product [Vitis vinifera] 87 2e-15 ref|XP_002268213.1| PREDICTED: protein CHLOROPLAST IMPORT APPARA... 87 2e-15 emb|CAN72725.1| hypothetical protein VITISV_015092 [Vitis vinifera] 87 2e-15 gb|ESW26707.1| hypothetical protein PHAVU_003G141200g [Phaseolus... 87 3e-15 ref|XP_006453246.1| hypothetical protein CICLE_v10008308mg [Citr... 86 4e-15 ref|XP_004296491.1| PREDICTED: protein CHLOROPLAST IMPORT APPARA... 86 4e-15 gb|EMJ26265.1| hypothetical protein PRUPE_ppa018578mg [Prunus pe... 86 4e-15 ref|XP_002533412.1| transcription factor, putative [Ricinus comm... 86 4e-15 ref|XP_006401232.1| hypothetical protein EUTSA_v10013517mg [Eutr... 86 6e-15 ref|XP_006280489.1| hypothetical protein CARUB_v10026429mg [Caps... 86 6e-15 ref|NP_568852.2| chloroplast import apparatus 2 protein [Arabido... 86 6e-15 ref|XP_002864503.1| hypothetical protein ARALYDRAFT_495815 [Arab... 86 6e-15 ref|XP_002308112.2| hypothetical protein POPTR_0006s07490g [Popu... 85 1e-14 ref|XP_006374368.1| hypothetical protein POPTR_0015s06480g [Popu... 85 1e-14 ref|XP_002324691.2| hypothetical protein POPTR_0018s13890g [Popu... 85 1e-14 >ref|XP_004507897.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Cicer arietinum] Length = 400 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/47 (91%), Positives = 47/47 (100%) Frame = +1 Query: 1 GVREASVLRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVRRLS 141 GVREASVLRYKEKRRTRLFSKKIRY+VRK+NA+RRPRMKGRFVRRL+ Sbjct: 352 GVREASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRRLN 398 >ref|XP_003549301.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Glycine max] Length = 398 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/47 (91%), Positives = 47/47 (100%) Frame = +1 Query: 1 GVREASVLRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVRRLS 141 GVREASVLRYKEKRRTRLFSKKIRY+VRK+NA+RRPRMKGRFVRRL+ Sbjct: 345 GVREASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRRLN 391 >ref|XP_003543009.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 1 [Glycine max] Length = 399 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/47 (91%), Positives = 47/47 (100%) Frame = +1 Query: 1 GVREASVLRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVRRLS 141 GVREASVLRYKEKRRTRLFSKKIRY+VRK+NA+RRPRMKGRFVRRL+ Sbjct: 347 GVREASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRRLN 393 >gb|EXC31212.1| Protein CHLOROPLAST IMPORT APPARATUS 2 [Morus notabilis] Length = 440 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +1 Query: 1 GVREASVLRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVRR 135 GVREASVLRYKEKRRTRLFSKKIRY+VRK+NA+RRPRMKGRFVRR Sbjct: 385 GVREASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR 429 >gb|EOY32042.1| Chloroplast import apparatus 2, putative isoform 1 [Theobroma cacao] Length = 410 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +1 Query: 1 GVREASVLRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVRR 135 GVREASVLRYKEKRRTRLFSKKIRY+VRK+NA+RRPRMKGRFVRR Sbjct: 360 GVREASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR 404 >emb|CBI40095.3| unnamed protein product [Vitis vinifera] Length = 392 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +1 Query: 1 GVREASVLRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVRR 135 GVREASVLRYKEKRRTRLFSKKIRY+VRK+NA+RRPRMKGRFVRR Sbjct: 339 GVREASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR 383 >ref|XP_002268213.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Vitis vinifera] Length = 392 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +1 Query: 1 GVREASVLRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVRR 135 GVREASVLRYKEKRRTRLFSKKIRY+VRK+NA+RRPRMKGRFVRR Sbjct: 339 GVREASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR 383 >emb|CAN72725.1| hypothetical protein VITISV_015092 [Vitis vinifera] Length = 392 Score = 87.4 bits (215), Expect = 2e-15 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +1 Query: 1 GVREASVLRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVRR 135 GVREASVLRYKEKRRTRLFSKKIRY+VRK+NA+RRPRMKGRFVRR Sbjct: 339 GVREASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR 383 >gb|ESW26707.1| hypothetical protein PHAVU_003G141200g [Phaseolus vulgaris] Length = 391 Score = 87.0 bits (214), Expect = 3e-15 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = +1 Query: 1 GVREASVLRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVRRLS 141 GVREASV RYKEKRRTRLFSKKIRY+VRK+NA+RRPRMKGRFVRRL+ Sbjct: 338 GVREASVQRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRRLN 384 >ref|XP_006453246.1| hypothetical protein CICLE_v10008308mg [Citrus clementina] gi|568840637|ref|XP_006474272.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform X1 [Citrus sinensis] gi|557556472|gb|ESR66486.1| hypothetical protein CICLE_v10008308mg [Citrus clementina] Length = 442 Score = 86.3 bits (212), Expect = 4e-15 Identities = 41/45 (91%), Positives = 45/45 (100%) Frame = +1 Query: 1 GVREASVLRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVRR 135 G+REASVLRYKEKRRTRLFSKKIRY+VRK+NA+RRPRMKGRFVRR Sbjct: 378 GLREASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR 422 >ref|XP_004296491.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 1 [Fragaria vesca subsp. vesca] Length = 430 Score = 86.3 bits (212), Expect = 4e-15 Identities = 41/45 (91%), Positives = 45/45 (100%) Frame = +1 Query: 1 GVREASVLRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVRR 135 G+REASVLRYKEKRRTRLFSKKIRY+VRK+NA+RRPRMKGRFVRR Sbjct: 373 GLREASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR 417 >gb|EMJ26265.1| hypothetical protein PRUPE_ppa018578mg [Prunus persica] Length = 440 Score = 86.3 bits (212), Expect = 4e-15 Identities = 41/45 (91%), Positives = 45/45 (100%) Frame = +1 Query: 1 GVREASVLRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVRR 135 G+REASVLRYKEKRRTRLFSKKIRY+VRK+NA+RRPRMKGRFVRR Sbjct: 382 GLREASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR 426 >ref|XP_002533412.1| transcription factor, putative [Ricinus communis] gi|223526741|gb|EEF28970.1| transcription factor, putative [Ricinus communis] Length = 430 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = +1 Query: 1 GVREASVLRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVRRLS 141 G REA VLRYKEKRRTRLFSKKIRYEVRKLNAE+RPRMKGRFV+R S Sbjct: 373 GAREARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTS 419 >ref|XP_006401232.1| hypothetical protein EUTSA_v10013517mg [Eutrema salsugineum] gi|557102322|gb|ESQ42685.1| hypothetical protein EUTSA_v10013517mg [Eutrema salsugineum] Length = 452 Score = 85.9 bits (211), Expect = 6e-15 Identities = 41/45 (91%), Positives = 45/45 (100%) Frame = +1 Query: 1 GVREASVLRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVRR 135 G+REASVLRYKEKRRTRLFSKKIRY+VRKLNA++RPRMKGRFVRR Sbjct: 398 GMREASVLRYKEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVRR 442 >ref|XP_006280489.1| hypothetical protein CARUB_v10026429mg [Capsella rubella] gi|482549193|gb|EOA13387.1| hypothetical protein CARUB_v10026429mg [Capsella rubella] Length = 436 Score = 85.9 bits (211), Expect = 6e-15 Identities = 41/45 (91%), Positives = 45/45 (100%) Frame = +1 Query: 1 GVREASVLRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVRR 135 G+REASVLRYKEKRRTRLFSKKIRY+VRKLNA++RPRMKGRFVRR Sbjct: 382 GMREASVLRYKEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVRR 426 >ref|NP_568852.2| chloroplast import apparatus 2 protein [Arabidopsis thaliana] gi|75180536|sp|Q9LU68.1|CIA2_ARATH RecName: Full=Protein CHLOROPLAST IMPORT APPARATUS 2; Flags: Precursor gi|13991646|gb|AAK51445.1|AF359387_1 CIA2 [Arabidopsis thaliana] gi|8843820|dbj|BAA97368.1| unnamed protein product [Arabidopsis thaliana] gi|222423094|dbj|BAH19527.1| AT5G57180 [Arabidopsis thaliana] gi|332009477|gb|AED96860.1| chloroplast import apparatus 2 protein [Arabidopsis thaliana] Length = 435 Score = 85.9 bits (211), Expect = 6e-15 Identities = 41/45 (91%), Positives = 45/45 (100%) Frame = +1 Query: 1 GVREASVLRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVRR 135 G+REASVLRYKEKRRTRLFSKKIRY+VRKLNA++RPRMKGRFVRR Sbjct: 381 GMREASVLRYKEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVRR 425 >ref|XP_002864503.1| hypothetical protein ARALYDRAFT_495815 [Arabidopsis lyrata subsp. lyrata] gi|297310338|gb|EFH40762.1| hypothetical protein ARALYDRAFT_495815 [Arabidopsis lyrata subsp. lyrata] Length = 426 Score = 85.9 bits (211), Expect = 6e-15 Identities = 41/45 (91%), Positives = 45/45 (100%) Frame = +1 Query: 1 GVREASVLRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVRR 135 G+REASVLRYKEKRRTRLFSKKIRY+VRKLNA++RPRMKGRFVRR Sbjct: 372 GMREASVLRYKEKRRTRLFSKKIRYQVRKLNADQRPRMKGRFVRR 416 >ref|XP_002308112.2| hypothetical protein POPTR_0006s07490g [Populus trichocarpa] gi|550335713|gb|EEE91635.2| hypothetical protein POPTR_0006s07490g [Populus trichocarpa] Length = 502 Score = 84.7 bits (208), Expect = 1e-14 Identities = 40/45 (88%), Positives = 45/45 (100%) Frame = +1 Query: 1 GVREASVLRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVRR 135 G+REASVLRYKEKRRTRLFSKKIRY+VRK+NA++RPRMKGRFVRR Sbjct: 390 GMREASVLRYKEKRRTRLFSKKIRYQVRKVNADQRPRMKGRFVRR 434 >ref|XP_006374368.1| hypothetical protein POPTR_0015s06480g [Populus trichocarpa] gi|550322127|gb|ERP52165.1| hypothetical protein POPTR_0015s06480g [Populus trichocarpa] Length = 425 Score = 84.7 bits (208), Expect = 1e-14 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = +1 Query: 1 GVREASVLRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVRRLS 141 G REA V+RYKEKRRTRLFSKKIRYEVRKLNAE+RPRMKGRFV+R S Sbjct: 371 GEREARVMRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTS 417 >ref|XP_002324691.2| hypothetical protein POPTR_0018s13890g [Populus trichocarpa] gi|550318702|gb|EEF03256.2| hypothetical protein POPTR_0018s13890g [Populus trichocarpa] Length = 467 Score = 84.7 bits (208), Expect = 1e-14 Identities = 40/45 (88%), Positives = 45/45 (100%) Frame = +1 Query: 1 GVREASVLRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVRR 135 G+REASVLRYKEKRRTRLFSKKIRY+VRK+NA++RPRMKGRFVRR Sbjct: 403 GMREASVLRYKEKRRTRLFSKKIRYQVRKVNADQRPRMKGRFVRR 447