BLASTX nr result
ID: Ephedra26_contig00013248
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00013248 (569 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006858722.1| hypothetical protein AMTR_s00066p00114140 [A... 60 3e-07 >ref|XP_006858722.1| hypothetical protein AMTR_s00066p00114140 [Amborella trichopoda] gi|548862833|gb|ERN20189.1| hypothetical protein AMTR_s00066p00114140 [Amborella trichopoda] Length = 890 Score = 60.5 bits (145), Expect = 3e-07 Identities = 44/108 (40%), Positives = 55/108 (50%), Gaps = 3/108 (2%) Frame = -2 Query: 460 AESVGRSEAAHEKSSTPEQRAQV-TPPVQPSICPEIHSQEVAQDAGKFFSAGHVRAPVSS 284 A SV + SSTP + ++ TPPV SI PEIHS + F AGHV A Sbjct: 256 AVSVDTPGSMKRMSSTPAKTSEKSTPPVMASISPEIHSGSLVIGTPAIFGAGHVVA---- 311 Query: 283 KGKVKDRRKCRPIGILICGEA-KPLPLDDD-HPRFSLLPDPAVAFVKW 146 +V DRRKC+P GIL G+ + L + R S L DP A +KW Sbjct: 312 --RVSDRRKCKPRGILTVGKGDETLGFSEGCEIRVSSLLDPEEASMKW 357