BLASTX nr result
ID: Ephedra26_contig00013207
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00013207 (401 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR18461.1| unknown [Picea sitchensis] 59 7e-07 gb|AEW08269.1| hypothetical protein 2_4643_01, partial [Pinus la... 59 9e-07 gb|AEW08268.1| hypothetical protein 2_4643_01, partial [Pinus ra... 58 1e-06 gb|AFG59112.1| hypothetical protein 2_4643_01, partial [Pinus ta... 58 1e-06 >gb|ABR18461.1| unknown [Picea sitchensis] Length = 386 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/64 (46%), Positives = 40/64 (62%) Frame = +3 Query: 6 SQLLEKTEVNNGVASSTNGVLPSKVLETQPGKEETVEFLHLIRLADSKFEINRGRSEWRK 185 S + T +NG A+STNGV ++ EFLH++RLA+S FEINRGR+EWR+ Sbjct: 323 SAVESSTFASNGNATSTNGVATTRSPGRLSSSSRGFEFLHMLRLAESGFEINRGRTEWRR 382 Query: 186 KLLR 197 K R Sbjct: 383 KPAR 386 >gb|AEW08269.1| hypothetical protein 2_4643_01, partial [Pinus lambertiana] Length = 86 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/55 (50%), Positives = 37/55 (67%) Frame = +3 Query: 33 NNGVASSTNGVLPSKVLETQPGKEETVEFLHLIRLADSKFEINRGRSEWRKKLLR 197 +NG A+STNG + + EFLH++RLA+S FEINRGR+EWR+KL R Sbjct: 32 SNGNAASTNGAATIRSPGSLSSNNSGFEFLHMLRLAESGFEINRGRTEWRRKLAR 86 >gb|AEW08268.1| hypothetical protein 2_4643_01, partial [Pinus radiata] Length = 86 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/55 (49%), Positives = 38/55 (69%) Frame = +3 Query: 33 NNGVASSTNGVLPSKVLETQPGKEETVEFLHLIRLADSKFEINRGRSEWRKKLLR 197 +NG A+STNG + + ++ EFLH++RL +S FEINRGR+EWR+KL R Sbjct: 32 SNGNATSTNGAATIRSPGSLSSNDKGFEFLHMLRLVESGFEINRGRTEWRRKLAR 86 >gb|AFG59112.1| hypothetical protein 2_4643_01, partial [Pinus taeda] gi|383153938|gb|AFG59113.1| hypothetical protein 2_4643_01, partial [Pinus taeda] gi|383153940|gb|AFG59114.1| hypothetical protein 2_4643_01, partial [Pinus taeda] gi|383153944|gb|AFG59116.1| hypothetical protein 2_4643_01, partial [Pinus taeda] gi|383153946|gb|AFG59117.1| hypothetical protein 2_4643_01, partial [Pinus taeda] gi|383153948|gb|AFG59118.1| hypothetical protein 2_4643_01, partial [Pinus taeda] gi|383153950|gb|AFG59119.1| hypothetical protein 2_4643_01, partial [Pinus taeda] gi|383153952|gb|AFG59120.1| hypothetical protein 2_4643_01, partial [Pinus taeda] gi|383153954|gb|AFG59121.1| hypothetical protein 2_4643_01, partial [Pinus taeda] gi|383153956|gb|AFG59122.1| hypothetical protein 2_4643_01, partial [Pinus taeda] gi|383153958|gb|AFG59123.1| hypothetical protein 2_4643_01, partial [Pinus taeda] gi|383153960|gb|AFG59124.1| hypothetical protein 2_4643_01, partial [Pinus taeda] gi|383153962|gb|AFG59125.1| hypothetical protein 2_4643_01, partial [Pinus taeda] gi|383153964|gb|AFG59126.1| hypothetical protein 2_4643_01, partial [Pinus taeda] gi|383153966|gb|AFG59127.1| hypothetical protein 2_4643_01, partial [Pinus taeda] gi|383153968|gb|AFG59128.1| hypothetical protein 2_4643_01, partial [Pinus taeda] gi|383153970|gb|AFG59129.1| hypothetical protein 2_4643_01, partial [Pinus taeda] Length = 86 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/55 (49%), Positives = 37/55 (67%) Frame = +3 Query: 33 NNGVASSTNGVLPSKVLETQPGKEETVEFLHLIRLADSKFEINRGRSEWRKKLLR 197 +NG A+STNG + + + EFLH++RL +S FEINRGR+EWR+KL R Sbjct: 32 SNGNATSTNGAATIRSPGSLSSNDRGFEFLHMLRLVESGFEINRGRTEWRRKLAR 86