BLASTX nr result
ID: Ephedra26_contig00012570
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00012570 (456 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003579192.1| PREDICTED: E3 ubiquitin protein ligase DRIP2... 59 7e-07 ref|XP_003520583.1| PREDICTED: E3 ubiquitin protein ligase DRIP2... 56 6e-06 gb|ESW34497.1| hypothetical protein PHAVU_001G157400g [Phaseolus... 55 1e-05 >ref|XP_003579192.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Brachypodium distachyon] Length = 479 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/51 (52%), Positives = 31/51 (60%) Frame = -3 Query: 157 IKVKKRQXXXXXXXXXXXXXXKEATTICECLHTFCRKCIYERLVEEENNSC 5 +KVKK +EATTICECLHTFCRKCIY++L EE N C Sbjct: 76 VKVKKENLAPRITCPLCQRYLREATTICECLHTFCRKCIYKKLAVEELNHC 126 >ref|XP_003520583.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Glycine max] Length = 445 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/59 (42%), Positives = 34/59 (57%) Frame = -3 Query: 181 RIAMSTHFIKVKKRQXXXXXXXXXXXXXXKEATTICECLHTFCRKCIYERLVEEENNSC 5 R +MS +KV++ +EATTI ECLHTFCRKCIY+++ +EE C Sbjct: 14 RSSMSNQVVKVRRNTIVACMTCPLCNKLFREATTISECLHTFCRKCIYDKITDEEIECC 72 >gb|ESW34497.1| hypothetical protein PHAVU_001G157400g [Phaseolus vulgaris] Length = 429 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/56 (44%), Positives = 33/56 (58%) Frame = -3 Query: 172 MSTHFIKVKKRQXXXXXXXXXXXXXXKEATTICECLHTFCRKCIYERLVEEENNSC 5 MS KV++ +EATTI ECLHTFCRKCIY+++++EE SC Sbjct: 1 MSNQVAKVRRNTIVACMTCPLCNKLFREATTISECLHTFCRKCIYDKIMDEELESC 56