BLASTX nr result
ID: Ephedra26_contig00012105
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00012105 (513 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006838635.1| hypothetical protein AMTR_s00002p00236690 [A... 57 3e-06 >ref|XP_006838635.1| hypothetical protein AMTR_s00002p00236690 [Amborella trichopoda] gi|548841141|gb|ERN01204.1| hypothetical protein AMTR_s00002p00236690 [Amborella trichopoda] Length = 586 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/56 (46%), Positives = 35/56 (62%) Frame = -2 Query: 248 KCMGSKCGFLTKISYPFGLSSDHGCGHPAFQVMCGSGNNPQILINNMTYNIGSTPS 81 K S C T SYPF LSS +GCGHPAFQ+ C +G++ ++ I Y + STP+ Sbjct: 39 KAAASSCPPFTSFSYPFALSSTNGCGHPAFQIDCTNGHS-KLTIGTQKYRVLSTPT 93