BLASTX nr result
ID: Ephedra26_contig00012025
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00012025 (550 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006853026.1| hypothetical protein AMTR_s00174p00061480 [A... 56 6e-06 >ref|XP_006853026.1| hypothetical protein AMTR_s00174p00061480 [Amborella trichopoda] gi|548856663|gb|ERN14493.1| hypothetical protein AMTR_s00174p00061480 [Amborella trichopoda] Length = 743 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 536 LAGQSIAELGCEPILHMRHFQSTGRLPQNLVDHI 435 L G+S+A+LGCEPILHMRHFQ+TG+L LVD I Sbjct: 701 LHGRSVADLGCEPILHMRHFQATGKLSDKLVDQI 734