BLASTX nr result
ID: Ephedra26_contig00011217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00011217 (621 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006858635.1| hypothetical protein AMTR_s00066p00041260 [A... 43 8e-08 >ref|XP_006858635.1| hypothetical protein AMTR_s00066p00041260 [Amborella trichopoda] gi|548862746|gb|ERN20102.1| hypothetical protein AMTR_s00066p00041260 [Amborella trichopoda] Length = 1046 Score = 43.1 bits (100), Expect(3) = 8e-08 Identities = 19/39 (48%), Positives = 27/39 (69%) Frame = +2 Query: 2 DVIAYTTMIDGFERGRKLNQALKILEEMKIKYCAPNAIT 118 +V+ YT MIDG+ + K++ LK+L EM K CAPN +T Sbjct: 791 NVVTYTAMIDGYGKVGKVDLGLKLLREMAEKGCAPNIVT 829 Score = 33.1 bits (74), Expect(3) = 8e-08 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Frame = +3 Query: 267 PLIASYVILLDHLSKVRYLESVLDFQKEII*LSSKLDT-SDISSYAMLIEALCKFGSKGC 443 P++ +Y IL+D L K LE L+ KE++ +S+ + ++Y+ LIE L G Sbjct: 893 PMVPAYSILIDSLCKAGRLEVALELHKEMVSVSTVQPCFAQKTAYSSLIEGLSLAGKIEK 952 Query: 444 IFE 452 FE Sbjct: 953 AFE 955 Score = 25.4 bits (54), Expect(3) = 8e-08 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = +1 Query: 142 EMKNTC*PIDGKQHTDMISGASQAFSTSHELLQEVSYFTKCP 267 EMK T P D+I G S F S LL E+S + P Sbjct: 852 EMKQTYWPPHALWFKDVIQGFSIEFINSLGLLHEISEYNMFP 893