BLASTX nr result
ID: Ephedra26_contig00011010
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00011010 (449 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006853801.1| hypothetical protein AMTR_s00056p00219450 [A... 55 1e-05 >ref|XP_006853801.1| hypothetical protein AMTR_s00056p00219450 [Amborella trichopoda] gi|548857462|gb|ERN15268.1| hypothetical protein AMTR_s00056p00219450 [Amborella trichopoda] Length = 849 Score = 55.1 bits (131), Expect = 1e-05 Identities = 31/80 (38%), Positives = 42/80 (52%), Gaps = 1/80 (1%) Frame = -1 Query: 443 LPTCLKSLQIANCPNLQRIGNLPIHLKYFDMSHCESVEVI-DVSDLHSLRRFHVRACSSL 267 LPT L L +++C NL IGNL L+ SHC S+++I D+S L L + C L Sbjct: 653 LPTSLNYLDVSHCVNLLAIGNLSTTLESLKASHCISLQIIPDLSQLSQLEELDLTDCKGL 712 Query: 266 KNIMGLIRLDGIKYLTIQEC 207 I GL L +K L + C Sbjct: 713 IEIQGLSGLKSLKTLHLHGC 732