BLASTX nr result
ID: Ephedra26_contig00010991
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00010991 (486 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB78109.1| Ubiquitin-conjugating enzyme E2 35 [Morus notabilis] 106 4e-21 ref|XP_006442524.1| hypothetical protein CICLE_v10022662mg [Citr... 106 4e-21 ref|XP_006442523.1| hypothetical protein CICLE_v10022662mg [Citr... 106 4e-21 ref|XP_006442521.1| hypothetical protein CICLE_v10022662mg [Citr... 106 4e-21 ref|XP_006442519.1| hypothetical protein CICLE_v10022662mg [Citr... 106 4e-21 gb|EOY13246.1| Ubiquitin-conjugating enzyme 36 isoform 1 [Theobr... 106 4e-21 gb|AFN85541.1| ubiquitin-conjugating enzyme, partial [Olea europ... 106 4e-21 ref|XP_003634668.1| PREDICTED: ubiquitin-conjugating enzyme E2 3... 106 4e-21 ref|XP_002316867.1| ubiquitin-conjugating enzyme family protein ... 106 4e-21 gb|ABK24341.1| unknown [Picea sitchensis] gi|116791120|gb|ABK258... 106 4e-21 ref|NP_001267560.1| ubiquitin-conjugating enzyme E2 35-like [Cuc... 106 4e-21 gb|EMJ13390.1| hypothetical protein PRUPE_ppa012814mg [Prunus pe... 105 5e-21 gb|ESW21392.1| hypothetical protein PHAVU_005G066900g [Phaseolus... 104 1e-20 ref|XP_006389951.1| hypothetical protein EUTSA_v10019278mg [Eutr... 104 1e-20 ref|XP_006302954.1| hypothetical protein CARUB_v10021093mg [Caps... 104 1e-20 ref|XP_004294139.1| PREDICTED: ubiquitin-conjugating enzyme E2 3... 104 1e-20 ref|NP_001241639.1| uncharacterized protein LOC100805631 [Glycin... 104 1e-20 ref|NP_849678.1| ubiquitin-conjugating enzyme E2 36 [Arabidopsis... 104 1e-20 ref|NP_564011.1| ubiquitin-conjugating enzyme E2 36 [Arabidopsis... 104 1e-20 gb|AFK36542.1| unknown [Lotus japonicus] 104 1e-20 >gb|EXB78109.1| Ubiquitin-conjugating enzyme E2 35 [Morus notabilis] Length = 153 Score = 106 bits (264), Expect = 4e-21 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 157 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS Sbjct: 100 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 151 >ref|XP_006442524.1| hypothetical protein CICLE_v10022662mg [Citrus clementina] gi|557544786|gb|ESR55764.1| hypothetical protein CICLE_v10022662mg [Citrus clementina] Length = 120 Score = 106 bits (264), Expect = 4e-21 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 157 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS Sbjct: 67 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 118 >ref|XP_006442523.1| hypothetical protein CICLE_v10022662mg [Citrus clementina] gi|557544785|gb|ESR55763.1| hypothetical protein CICLE_v10022662mg [Citrus clementina] Length = 151 Score = 106 bits (264), Expect = 4e-21 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 157 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS Sbjct: 98 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 149 >ref|XP_006442521.1| hypothetical protein CICLE_v10022662mg [Citrus clementina] gi|557544783|gb|ESR55761.1| hypothetical protein CICLE_v10022662mg [Citrus clementina] Length = 139 Score = 106 bits (264), Expect = 4e-21 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 157 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS Sbjct: 86 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 137 >ref|XP_006442519.1| hypothetical protein CICLE_v10022662mg [Citrus clementina] gi|557544781|gb|ESR55759.1| hypothetical protein CICLE_v10022662mg [Citrus clementina] Length = 143 Score = 106 bits (264), Expect = 4e-21 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 157 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS Sbjct: 90 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 141 >gb|EOY13246.1| Ubiquitin-conjugating enzyme 36 isoform 1 [Theobroma cacao] Length = 204 Score = 106 bits (264), Expect = 4e-21 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 157 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS Sbjct: 151 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 202 >gb|AFN85541.1| ubiquitin-conjugating enzyme, partial [Olea europaea] Length = 90 Score = 106 bits (264), Expect = 4e-21 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 157 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS Sbjct: 37 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 88 >ref|XP_003634668.1| PREDICTED: ubiquitin-conjugating enzyme E2 35 isoform 2 [Vitis vinifera] Length = 167 Score = 106 bits (264), Expect = 4e-21 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 157 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS Sbjct: 114 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 165 >ref|XP_002316867.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa] gi|118484002|gb|ABK93888.1| unknown [Populus trichocarpa] gi|118487650|gb|ABK95650.1| unknown [Populus trichocarpa] gi|222859932|gb|EEE97479.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa] Length = 153 Score = 106 bits (264), Expect = 4e-21 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 157 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS Sbjct: 100 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 151 >gb|ABK24341.1| unknown [Picea sitchensis] gi|116791120|gb|ABK25864.1| unknown [Picea sitchensis] gi|224287055|gb|ACN41228.1| unknown [Picea sitchensis] Length = 153 Score = 106 bits (264), Expect = 4e-21 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 157 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS Sbjct: 100 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 151 >ref|NP_001267560.1| ubiquitin-conjugating enzyme E2 35-like [Cucumis sativus] gi|572152895|ref|NP_001275770.1| ubiquitin-conjugating enzyme 13 [Citrus sinensis] gi|225461646|ref|XP_002285421.1| PREDICTED: ubiquitin-conjugating enzyme E2 35 isoform 1 [Vitis vinifera] gi|255564766|ref|XP_002523377.1| Ubiquitin-conjugating enzyme E2 N, putative [Ricinus communis] gi|449483162|ref|XP_004156510.1| PREDICTED: ubiquitin-conjugating enzyme E2 35-like [Cucumis sativus] gi|567900068|ref|XP_006442522.1| hypothetical protein CICLE_v10022662mg [Citrus clementina] gi|223537327|gb|EEF38956.1| Ubiquitin-conjugating enzyme E2 N, putative [Ricinus communis] gi|258456188|gb|ACV72277.1| ubiquitin-conjugating enzyme 13 [Citrus sinensis] gi|298352995|gb|ADI76991.1| putative ubiquitin-conjugating enzyme [Cucumis sativus] gi|298352997|gb|ADI76992.1| putative ubiquitin-conjugating enzyme [Cucumis sativus] gi|302142905|emb|CBI20200.3| unnamed protein product [Vitis vinifera] gi|317159577|gb|ADV04063.1| protein binding/ubiquitin-protein ligase 2 [Hevea brasiliensis] gi|523713525|gb|AGQ57016.1| ubiquitin-conjugating enzyme E2N [Hevea brasiliensis] gi|557544784|gb|ESR55762.1| hypothetical protein CICLE_v10022662mg [Citrus clementina] Length = 153 Score = 106 bits (264), Expect = 4e-21 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 157 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS Sbjct: 100 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 151 >gb|EMJ13390.1| hypothetical protein PRUPE_ppa012814mg [Prunus persica] Length = 153 Score = 105 bits (263), Expect = 5e-21 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = +2 Query: 2 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 157 ALQIRTVLLS+QALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS Sbjct: 100 ALQIRTVLLSVQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 151 >gb|ESW21392.1| hypothetical protein PHAVU_005G066900g [Phaseolus vulgaris] Length = 153 Score = 104 bits (260), Expect = 1e-20 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = +2 Query: 2 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYA 154 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYA Sbjct: 100 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYA 150 >ref|XP_006389951.1| hypothetical protein EUTSA_v10019278mg [Eutrema salsugineum] gi|557086385|gb|ESQ27237.1| hypothetical protein EUTSA_v10019278mg [Eutrema salsugineum] Length = 153 Score = 104 bits (260), Expect = 1e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = +2 Query: 2 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 157 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWK+NEAEAVETAKEWTRLYAS Sbjct: 100 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYAS 151 >ref|XP_006302954.1| hypothetical protein CARUB_v10021093mg [Capsella rubella] gi|482571664|gb|EOA35852.1| hypothetical protein CARUB_v10021093mg [Capsella rubella] Length = 153 Score = 104 bits (260), Expect = 1e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = +2 Query: 2 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 157 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWK+NEAEAVETAKEWTRLYAS Sbjct: 100 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYAS 151 >ref|XP_004294139.1| PREDICTED: ubiquitin-conjugating enzyme E2 35-like [Fragaria vesca subsp. vesca] gi|462409713|gb|EMJ15047.1| hypothetical protein PRUPE_ppa012813mg [Prunus persica] Length = 153 Score = 104 bits (260), Expect = 1e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = +2 Query: 2 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 157 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWK+NEAEAVETAKEWTRLYAS Sbjct: 100 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYAS 151 >ref|NP_001241639.1| uncharacterized protein LOC100805631 [Glycine max] gi|297839753|ref|XP_002887758.1| ubiquitin-conjugating enzyme 1 [Arabidopsis lyrata subsp. lyrata] gi|71040675|gb|AAZ20286.1| ubiquitin-conjugating enzyme 1 [Arachis hypogaea] gi|217075352|gb|ACJ86036.1| unknown [Medicago truncatula] gi|255628881|gb|ACU14785.1| unknown [Glycine max] gi|255641415|gb|ACU20984.1| unknown [Glycine max] gi|297333599|gb|EFH64017.1| ubiquitin-conjugating enzyme 1 [Arabidopsis lyrata subsp. lyrata] gi|378464294|gb|AFC01194.1| ubiquitin-conjugating enzyme [Ammopiptanthus mongolicus] gi|388491284|gb|AFK33708.1| unknown [Medicago truncatula] gi|557880983|gb|AHA42249.1| Fen-interacting protein 3 [Nicotiana benthamiana] Length = 153 Score = 104 bits (260), Expect = 1e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = +2 Query: 2 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 157 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWK+NEAEAVETAKEWTRLYAS Sbjct: 100 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYAS 151 >ref|NP_849678.1| ubiquitin-conjugating enzyme E2 36 [Arabidopsis thaliana] gi|332191394|gb|AEE29515.1| ubiquitin-conjugating enzyme E2 36 [Arabidopsis thaliana] Length = 120 Score = 104 bits (260), Expect = 1e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = +2 Query: 2 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 157 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWK+NEAEAVETAKEWTRLYAS Sbjct: 67 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYAS 118 >ref|NP_564011.1| ubiquitin-conjugating enzyme E2 36 [Arabidopsis thaliana] gi|567757547|ref|NP_001274716.1| ubiquitin-conjugating enzyme E2 36-like [Solanum lycopersicum] gi|225446595|ref|XP_002280480.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 isoform 1 [Vitis vinifera] gi|297850090|ref|XP_002892926.1| hypothetical protein ARALYDRAFT_889082 [Arabidopsis lyrata subsp. lyrata] gi|565491510|ref|XP_006303394.1| hypothetical protein CARUB_v10010547mg [Capsella rubella] gi|75334547|sp|Q9FZ48.1|UBC36_ARATH RecName: Full=Ubiquitin-conjugating enzyme E2 36; AltName: Full=Ubiquitin carrier protein 36 gi|9802775|gb|AAF99844.1|AC051629_11 Putative ubiquitin-conjugating enzyme E2 [Arabidopsis thaliana] gi|15450413|gb|AAK96500.1| At1g16890/F17F16.16 [Arabidopsis thaliana] gi|16974499|gb|AAL31253.1| At1g16890/F17F16.16 [Arabidopsis thaliana] gi|21555312|gb|AAM63831.1| E2, ubiquitin-conjugating enzyme, putative [Arabidopsis thaliana] gi|66354480|gb|AAY44875.1| ubiquitinating enzyme [Arabidopsis thaliana] gi|297338768|gb|EFH69185.1| hypothetical protein ARALYDRAFT_889082 [Arabidopsis lyrata subsp. lyrata] gi|302143419|emb|CBI21980.3| unnamed protein product [Vitis vinifera] gi|332191395|gb|AEE29516.1| ubiquitin-conjugating enzyme E2 36 [Arabidopsis thaliana] gi|482572105|gb|EOA36292.1| hypothetical protein CARUB_v10010547mg [Capsella rubella] gi|557880985|gb|AHA42250.1| Ubc13-type ubiquitin-conjugating enzyme 2 [Solanum lycopersicum] gi|557880987|gb|AHA42251.1| Ubc13-type ubiquitin-conjugating enzyme 2 [Nicotiana benthamiana] Length = 153 Score = 104 bits (260), Expect = 1e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = +2 Query: 2 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 157 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWK+NEAEAVETAKEWTRLYAS Sbjct: 100 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYAS 151 >gb|AFK36542.1| unknown [Lotus japonicus] Length = 153 Score = 104 bits (260), Expect = 1e-20 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = +2 Query: 2 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 157 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWK+NEAEAVETAKEWTRLYAS Sbjct: 100 ALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYAS 151