BLASTX nr result
ID: Ephedra26_contig00010959
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00010959 (562 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004504674.1| PREDICTED: probable CCR4-associated factor 1... 57 4e-06 >ref|XP_004504674.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Cicer arietinum] Length = 282 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = +3 Query: 456 MSTLLPFSETLEIREVWAENLEEEFARIREIVDDY 560 MS +LP S++++IREVW++NLEEEFA IREIVDDY Sbjct: 7 MSLILPKSDSIQIREVWSDNLEEEFALIREIVDDY 41