BLASTX nr result
ID: Ephedra26_contig00010545
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00010545 (530 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB38863.1| Zinc finger CCCH domain-containing protein 65 [Mo... 60 2e-07 gb|EOY30416.1| Uncharacterized protein isoform 1 [Theobroma caca... 59 9e-07 ref|XP_006828099.1| hypothetical protein AMTR_s00151p00084810 [A... 57 3e-06 ref|XP_002522601.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 gb|EMT28341.1| Zinc finger CCCH domain-containing protein 7 [Aeg... 57 3e-06 gb|EMS56091.1| Zinc finger CCCH domain-containing protein 7 [Tri... 57 3e-06 ref|XP_004513885.1| PREDICTED: uncharacterized protein LOC101495... 55 8e-06 ref|XP_004513883.1| PREDICTED: uncharacterized protein LOC101495... 55 8e-06 gb|EPS68469.1| hypothetical protein M569_06299, partial [Genlise... 55 1e-05 emb|CBI27895.3| unnamed protein product [Vitis vinifera] 55 1e-05 >gb|EXB38863.1| Zinc finger CCCH domain-containing protein 65 [Morus notabilis] Length = 1064 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = +2 Query: 392 GIKRLHLSLITKPKPKSVCKYYMRGNCGHGSNCTYSHDGVPDTKSQ 529 G+KRL L LI+KPK S C++Y+ G C G NC +SHD VP TKS+ Sbjct: 528 GVKRLKLPLISKPKTVSYCRHYLNGRCQEGDNCKFSHDIVPLTKSK 573 >gb|EOY30416.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508783161|gb|EOY30417.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508783162|gb|EOY30418.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508783163|gb|EOY30419.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 962 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/46 (52%), Positives = 31/46 (67%) Frame = +2 Query: 392 GIKRLHLSLITKPKPKSVCKYYMRGNCGHGSNCTYSHDGVPDTKSQ 529 G+KRL L + KPK + C++Y++G C G C YSHD VP TKSQ Sbjct: 440 GVKRLKLQTVLKPKSVTYCRHYLKGRCYEGEKCKYSHDTVPLTKSQ 485 >ref|XP_006828099.1| hypothetical protein AMTR_s00151p00084810 [Amborella trichopoda] gi|548832745|gb|ERM95515.1| hypothetical protein AMTR_s00151p00084810 [Amborella trichopoda] Length = 347 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/46 (52%), Positives = 33/46 (71%) Frame = +2 Query: 392 GIKRLHLSLITKPKPKSVCKYYMRGNCGHGSNCTYSHDGVPDTKSQ 529 GIKRL L +TK KP +C++YM+G C G +C +SHD +P TKS+ Sbjct: 60 GIKRLKLMPVTKAKPVVLCQFYMKGRCNLGLSCKFSHDTIPLTKSK 105 >ref|XP_002522601.1| conserved hypothetical protein [Ricinus communis] gi|223538077|gb|EEF39688.1| conserved hypothetical protein [Ricinus communis] Length = 932 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/46 (50%), Positives = 31/46 (67%) Frame = +2 Query: 392 GIKRLHLSLITKPKPKSVCKYYMRGNCGHGSNCTYSHDGVPDTKSQ 529 G+KRL L + KPKP C++Y+RG C G C +SHD +P TKS+ Sbjct: 474 GVKRLKLRPVEKPKPVVFCRHYIRGRCQEGEKCKFSHDTIPLTKSK 519 >gb|EMT28341.1| Zinc finger CCCH domain-containing protein 7 [Aegilops tauschii] Length = 683 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/46 (50%), Positives = 31/46 (67%) Frame = +2 Query: 392 GIKRLHLSLITKPKPKSVCKYYMRGNCGHGSNCTYSHDGVPDTKSQ 529 G+KRL L+ + KPKP +C +YM G C G+ C +SHD P TKS+ Sbjct: 402 GVKRLKLAPVIKPKPVKLCHFYMHGKCQQGNACKFSHDTTPLTKSK 447 >gb|EMS56091.1| Zinc finger CCCH domain-containing protein 7 [Triticum urartu] Length = 613 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/46 (50%), Positives = 31/46 (67%) Frame = +2 Query: 392 GIKRLHLSLITKPKPKSVCKYYMRGNCGHGSNCTYSHDGVPDTKSQ 529 G+KRL L+ + KPKP +C +YM G C G+ C +SHD P TKS+ Sbjct: 332 GVKRLKLAPVIKPKPVKLCHFYMHGKCQQGNACKFSHDTTPLTKSK 377 >ref|XP_004513885.1| PREDICTED: uncharacterized protein LOC101495956 isoform X3 [Cicer arietinum] Length = 900 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/45 (51%), Positives = 28/45 (62%) Frame = +2 Query: 392 GIKRLHLSLITKPKPKSVCKYYMRGNCGHGSNCTYSHDGVPDTKS 526 G+KRL L + KPK C++YM G C G C +SHD VP TKS Sbjct: 509 GVKRLKLIPVQKPKTIQYCRHYMNGRCHEGDKCNFSHDTVPSTKS 553 >ref|XP_004513883.1| PREDICTED: uncharacterized protein LOC101495956 isoform X1 [Cicer arietinum] gi|502166412|ref|XP_004513884.1| PREDICTED: uncharacterized protein LOC101495956 isoform X2 [Cicer arietinum] Length = 901 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/45 (51%), Positives = 28/45 (62%) Frame = +2 Query: 392 GIKRLHLSLITKPKPKSVCKYYMRGNCGHGSNCTYSHDGVPDTKS 526 G+KRL L + KPK C++YM G C G C +SHD VP TKS Sbjct: 510 GVKRLKLIPVQKPKTIQYCRHYMNGRCHEGDKCNFSHDTVPSTKS 554 >gb|EPS68469.1| hypothetical protein M569_06299, partial [Genlisea aurea] Length = 129 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/46 (47%), Positives = 31/46 (67%) Frame = +2 Query: 392 GIKRLHLSLITKPKPKSVCKYYMRGNCGHGSNCTYSHDGVPDTKSQ 529 G+KRL L ++KP K C++Y++G C G C +SHD VP TKS+ Sbjct: 37 GVKRLKLPPVSKPIAKQPCRHYLKGKCNQGEKCNFSHDVVPLTKSK 82 >emb|CBI27895.3| unnamed protein product [Vitis vinifera] Length = 675 Score = 55.1 bits (131), Expect = 1e-05 Identities = 21/45 (46%), Positives = 32/45 (71%) Frame = +2 Query: 392 GIKRLHLSLITKPKPKSVCKYYMRGNCGHGSNCTYSHDGVPDTKS 526 G+KRL L ++KPK + C++Y++G C G +C +SHD +P TKS Sbjct: 216 GVKRLRLLPVSKPKTVTYCRHYLKGRCHEGDHCRFSHDTIPLTKS 260