BLASTX nr result
ID: Ephedra26_contig00010086
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00010086 (428 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK22515.1| unknown [Picea sitchensis] 92 9e-17 ref|XP_004145093.1| PREDICTED: thioredoxin-like protein CXXS1-li... 88 1e-15 gb|ABK22253.1| unknown [Picea sitchensis] gi|148909688|gb|ABR179... 88 1e-15 gb|EXB51989.1| Thioredoxin-like protein CXXS1 [Morus notabilis] 87 3e-15 ref|XP_002961777.1| hypothetical protein SELMODRAFT_438048 [Sela... 87 3e-15 gb|ACH60925.1| thioredoxin-like protein [Pseudotsuga menziesii] ... 87 3e-15 gb|ACH60923.1| thioredoxin-like protein [Pseudotsuga menziesii] ... 87 3e-15 gb|ACH60913.1| thioredoxin-like protein [Pseudotsuga menziesii] 87 3e-15 gb|ACH60912.1| thioredoxin-like protein [Pseudotsuga menziesii] ... 87 3e-15 gb|ACH60910.1| thioredoxin-like protein [Pseudotsuga menziesii] ... 87 3e-15 gb|ACH60907.1| thioredoxin-like protein [Pseudotsuga menziesii] ... 87 3e-15 gb|ABK23327.1| unknown [Picea sitchensis] 86 4e-15 gb|AAD33596.1|AF133127_1 thioredoxin h [Hevea brasiliensis] 86 7e-15 gb|AFC01208.1| thioredoxin [Ammopiptanthus mongolicus] 85 1e-14 gb|AFK33988.1| unknown [Lotus japonicus] gi|388505290|gb|AFK4071... 84 1e-14 gb|AFK46049.1| unknown [Medicago truncatula] 84 2e-14 ref|XP_003593373.1| Thioredoxin-like protein [Medicago truncatul... 84 2e-14 ref|XP_004309657.1| PREDICTED: thioredoxin-like protein CXXS1-li... 83 4e-14 ref|XP_004505427.1| PREDICTED: thioredoxin-like protein CXXS1-li... 82 6e-14 ref|XP_004485661.1| PREDICTED: thioredoxin-like protein CXXS1-li... 82 6e-14 >gb|ABK22515.1| unknown [Picea sitchensis] Length = 128 Score = 91.7 bits (226), Expect = 9e-17 Identities = 49/95 (51%), Positives = 66/95 (69%), Gaps = 6/95 (6%) Frame = -3 Query: 309 MNAQGRLSMEAQRRLSIDSQG------RQHQSKXXXMVAHFSADWCAPSKFMAPFFRSMS 148 M+AQ +++ A R L +DS RQ Q + +V HF+ADWCAPSK+M FF +++ Sbjct: 1 MDAQKQIT--ASRVLLVDSDKSWDIILRQAQVQACPVVVHFTADWCAPSKYMTGFFENLA 58 Query: 147 LDYPDILFLRVDMDELKEIAAKLNVKAMPTFLLMK 43 L YP ILFL VD+DE+K + K++VKAMPTFLLMK Sbjct: 59 LKYPRILFLLVDVDEVKGVKDKMDVKAMPTFLLMK 93 >ref|XP_004145093.1| PREDICTED: thioredoxin-like protein CXXS1-like [Cucumis sativus] gi|449474429|ref|XP_004154170.1| PREDICTED: thioredoxin-like protein CXXS1-like [Cucumis sativus] gi|449520762|ref|XP_004167402.1| PREDICTED: thioredoxin-like protein CXXS1-like [Cucumis sativus] Length = 123 Score = 88.2 bits (217), Expect = 1e-15 Identities = 38/59 (64%), Positives = 48/59 (81%) Frame = -3 Query: 219 MVAHFSADWCAPSKFMAPFFRSMSLDYPDILFLRVDMDELKEIAAKLNVKAMPTFLLMK 43 +V HF+A WC PS M PFF ++L YPD+LFL VD+DE+KE+AAKL +KAMPTFL+MK Sbjct: 35 IVVHFTASWCMPSVAMNPFFEELALTYPDVLFLTVDVDEVKEVAAKLEIKAMPTFLVMK 93 >gb|ABK22253.1| unknown [Picea sitchensis] gi|148909688|gb|ABR17935.1| unknown [Picea sitchensis] Length = 128 Score = 87.8 bits (216), Expect = 1e-15 Identities = 40/67 (59%), Positives = 52/67 (77%) Frame = -3 Query: 243 QHQSKXXXMVAHFSADWCAPSKFMAPFFRSMSLDYPDILFLRVDMDELKEIAAKLNVKAM 64 Q Q + + HF+ADWCAPSK+MA FF +++L YP ILFL VD+DE+K + K++VKAM Sbjct: 27 QAQLQACPVAVHFTADWCAPSKYMAGFFENLALKYPHILFLLVDVDEVKGVKDKMDVKAM 86 Query: 63 PTFLLMK 43 PTFLLMK Sbjct: 87 PTFLLMK 93 >gb|EXB51989.1| Thioredoxin-like protein CXXS1 [Morus notabilis] Length = 107 Score = 86.7 bits (213), Expect = 3e-15 Identities = 38/70 (54%), Positives = 52/70 (74%) Frame = -3 Query: 252 QGRQHQSKXXXMVAHFSADWCAPSKFMAPFFRSMSLDYPDILFLRVDMDELKEIAAKLNV 73 Q QSK +V HF+A WC PS M P F ++ +YPD+LFL VD+DELKE+A+++++ Sbjct: 6 QQEVQQSKARVIVVHFTASWCMPSVAMNPIFEELASNYPDVLFLVVDVDELKEVASRMDI 65 Query: 72 KAMPTFLLMK 43 KAMPTFLLM+ Sbjct: 66 KAMPTFLLMR 75 >ref|XP_002961777.1| hypothetical protein SELMODRAFT_438048 [Selaginella moellendorffii] gi|302762851|ref|XP_002964847.1| hypothetical protein SELMODRAFT_83714 [Selaginella moellendorffii] gi|300167080|gb|EFJ33685.1| hypothetical protein SELMODRAFT_83714 [Selaginella moellendorffii] gi|300170436|gb|EFJ37037.1| hypothetical protein SELMODRAFT_438048 [Selaginella moellendorffii] Length = 115 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/73 (54%), Positives = 54/73 (73%) Frame = -3 Query: 246 RQHQSKXXXMVAHFSADWCAPSKFMAPFFRSMSLDYPDILFLRVDMDELKEIAAKLNVKA 67 +Q +S+ +VAHFSADWCAP K+MA FR S + ++FL VD+DELKEIA +L VKA Sbjct: 19 KQAKSQDAIIVAHFSADWCAPCKYMASTFREASTRFLKLIFLTVDVDELKEIATRLEVKA 78 Query: 66 MPTFLLMKPQEGL 28 MPTF+ +K +E + Sbjct: 79 MPTFVFIKDEEAI 91 >gb|ACH60925.1| thioredoxin-like protein [Pseudotsuga menziesii] gi|197309150|gb|ACH60926.1| thioredoxin-like protein [Pseudotsuga menziesii] gi|197309158|gb|ACH60930.1| thioredoxin-like protein [Pseudotsuga macrocarpa] Length = 120 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/67 (58%), Positives = 51/67 (76%) Frame = -3 Query: 243 QHQSKXXXMVAHFSADWCAPSKFMAPFFRSMSLDYPDILFLRVDMDELKEIAAKLNVKAM 64 Q + + + HF+ADWCAPSK+MA FF ++L Y DILFL VD+DE+K + K++VKAM Sbjct: 8 QARDQACPVAVHFTADWCAPSKYMAGFFEDLALKYQDILFLLVDVDEVKGVKEKMDVKAM 67 Query: 63 PTFLLMK 43 PTFLLMK Sbjct: 68 PTFLLMK 74 >gb|ACH60923.1| thioredoxin-like protein [Pseudotsuga menziesii] gi|197309146|gb|ACH60924.1| thioredoxin-like protein [Pseudotsuga menziesii] Length = 120 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/67 (58%), Positives = 51/67 (76%) Frame = -3 Query: 243 QHQSKXXXMVAHFSADWCAPSKFMAPFFRSMSLDYPDILFLRVDMDELKEIAAKLNVKAM 64 Q + + + HF+ADWCAPSK+MA FF ++L Y DILFL VD+DE+K + K++VKAM Sbjct: 8 QARDQACPVAVHFTADWCAPSKYMAGFFEDLALKYQDILFLLVDVDEVKGVKEKMDVKAM 67 Query: 63 PTFLLMK 43 PTFLLMK Sbjct: 68 PTFLLMK 74 >gb|ACH60913.1| thioredoxin-like protein [Pseudotsuga menziesii] Length = 120 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/67 (58%), Positives = 51/67 (76%) Frame = -3 Query: 243 QHQSKXXXMVAHFSADWCAPSKFMAPFFRSMSLDYPDILFLRVDMDELKEIAAKLNVKAM 64 Q + + + HF+ADWCAPSK+MA FF ++L Y DILFL VD+DE+K + K++VKAM Sbjct: 8 QARDQACPVAVHFTADWCAPSKYMAGFFEDLALKYQDILFLLVDVDEVKGVKEKMDVKAM 67 Query: 63 PTFLLMK 43 PTFLLMK Sbjct: 68 PTFLLMK 74 >gb|ACH60912.1| thioredoxin-like protein [Pseudotsuga menziesii] gi|197309128|gb|ACH60915.1| thioredoxin-like protein [Pseudotsuga menziesii] Length = 119 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/67 (58%), Positives = 51/67 (76%) Frame = -3 Query: 243 QHQSKXXXMVAHFSADWCAPSKFMAPFFRSMSLDYPDILFLRVDMDELKEIAAKLNVKAM 64 Q + + + HF+ADWCAPSK+MA FF ++L Y DILFL VD+DE+K + K++VKAM Sbjct: 8 QARDQACPVAVHFTADWCAPSKYMAGFFEDLALKYQDILFLLVDVDEVKGVKEKMDVKAM 67 Query: 63 PTFLLMK 43 PTFLLMK Sbjct: 68 PTFLLMK 74 >gb|ACH60910.1| thioredoxin-like protein [Pseudotsuga menziesii] gi|197309120|gb|ACH60911.1| thioredoxin-like protein [Pseudotsuga menziesii] gi|197309142|gb|ACH60922.1| thioredoxin-like protein [Pseudotsuga menziesii] Length = 118 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/67 (58%), Positives = 51/67 (76%) Frame = -3 Query: 243 QHQSKXXXMVAHFSADWCAPSKFMAPFFRSMSLDYPDILFLRVDMDELKEIAAKLNVKAM 64 Q + + + HF+ADWCAPSK+MA FF ++L Y DILFL VD+DE+K + K++VKAM Sbjct: 8 QARDQACPVAVHFTADWCAPSKYMAGFFEDLALKYQDILFLLVDVDEVKGVKEKMDVKAM 67 Query: 63 PTFLLMK 43 PTFLLMK Sbjct: 68 PTFLLMK 74 >gb|ACH60907.1| thioredoxin-like protein [Pseudotsuga menziesii] gi|197309114|gb|ACH60908.1| thioredoxin-like protein [Pseudotsuga menziesii] gi|197309116|gb|ACH60909.1| thioredoxin-like protein [Pseudotsuga menziesii] gi|197309126|gb|ACH60914.1| thioredoxin-like protein [Pseudotsuga menziesii] gi|197309130|gb|ACH60916.1| thioredoxin-like protein [Pseudotsuga menziesii] gi|197309132|gb|ACH60917.1| thioredoxin-like protein [Pseudotsuga menziesii] gi|197309134|gb|ACH60918.1| thioredoxin-like protein [Pseudotsuga menziesii] gi|197309136|gb|ACH60919.1| thioredoxin-like protein [Pseudotsuga menziesii] gi|197309138|gb|ACH60920.1| thioredoxin-like protein [Pseudotsuga menziesii] gi|197309140|gb|ACH60921.1| thioredoxin-like protein [Pseudotsuga menziesii] gi|197309152|gb|ACH60927.1| thioredoxin-like protein [Pseudotsuga menziesii] gi|197309154|gb|ACH60928.1| thioredoxin-like protein [Pseudotsuga menziesii] gi|197309156|gb|ACH60929.1| thioredoxin-like protein [Pseudotsuga menziesii] Length = 120 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/67 (58%), Positives = 51/67 (76%) Frame = -3 Query: 243 QHQSKXXXMVAHFSADWCAPSKFMAPFFRSMSLDYPDILFLRVDMDELKEIAAKLNVKAM 64 Q + + + HF+ADWCAPSK+MA FF ++L Y DILFL VD+DE+K + K++VKAM Sbjct: 8 QARDQACPVAVHFTADWCAPSKYMAGFFEDLALKYQDILFLLVDVDEVKGVKEKMDVKAM 67 Query: 63 PTFLLMK 43 PTFLLMK Sbjct: 68 PTFLLMK 74 >gb|ABK23327.1| unknown [Picea sitchensis] Length = 128 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/67 (58%), Positives = 52/67 (77%) Frame = -3 Query: 243 QHQSKXXXMVAHFSADWCAPSKFMAPFFRSMSLDYPDILFLRVDMDELKEIAAKLNVKAM 64 Q ++ +V +F+A WCAPSK+MA FF +++L YPDILFL VD+DE+K + K+ VKAM Sbjct: 27 QAHARACPVVVYFTAYWCAPSKYMAGFFENLALKYPDILFLLVDVDEVKRVKDKMEVKAM 86 Query: 63 PTFLLMK 43 PTFLLMK Sbjct: 87 PTFLLMK 93 >gb|AAD33596.1|AF133127_1 thioredoxin h [Hevea brasiliensis] Length = 125 Score = 85.5 bits (210), Expect = 7e-15 Identities = 38/67 (56%), Positives = 50/67 (74%) Frame = -3 Query: 243 QHQSKXXXMVAHFSADWCAPSKFMAPFFRSMSLDYPDILFLRVDMDELKEIAAKLNVKAM 64 Q ++ +V HF+A WC PS M PFF ++ YPD+LFL VD+DE+KE+A+KL VKAM Sbjct: 27 QANNQGCPIVVHFTASWCIPSVAMNPFFEELASAYPDVLFLAVDVDEVKEVASKLEVKAM 86 Query: 63 PTFLLMK 43 PTF+LMK Sbjct: 87 PTFVLMK 93 >gb|AFC01208.1| thioredoxin [Ammopiptanthus mongolicus] Length = 124 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/80 (47%), Positives = 56/80 (70%), Gaps = 3/80 (3%) Frame = -3 Query: 264 SIDSQGRQHQSKXXXMVAHFSADWCAPSKFMAPFFRSMSLDYPDILFLRVDMDELKEIAA 85 S +S Q ++ +V HF+A WC PS M PFF ++ YPD+LFL VD+DE+K++A Sbjct: 19 SWESYVTQASNQNCPIVVHFTASWCMPSVVMTPFFEELASSYPDVLFLTVDVDEVKDVAT 78 Query: 84 KLNVKAMPTFLLMK---PQE 34 ++++KAMPTF+L+K PQE Sbjct: 79 RMDIKAMPTFVLLKDGAPQE 98 >gb|AFK33988.1| unknown [Lotus japonicus] gi|388505290|gb|AFK40711.1| unknown [Lotus japonicus] Length = 123 Score = 84.3 bits (207), Expect = 1e-14 Identities = 38/76 (50%), Positives = 51/76 (67%) Frame = -3 Query: 243 QHQSKXXXMVAHFSADWCAPSKFMAPFFRSMSLDYPDILFLRVDMDELKEIAAKLNVKAM 64 Q ++ +V HFSA WC PS M PFF M+ YPD LFL VD+DE+K++A +L +KAM Sbjct: 25 QASNQNCPIVVHFSASWCMPSVAMNPFFEDMASSYPDFLFLNVDVDEVKDVATRLEIKAM 84 Query: 63 PTFLLMKPQEGLEEQV 16 PTF+ +K LE+ V Sbjct: 85 PTFVFLKDGAPLEKLV 100 >gb|AFK46049.1| unknown [Medicago truncatula] Length = 124 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/67 (55%), Positives = 48/67 (71%) Frame = -3 Query: 243 QHQSKXXXMVAHFSADWCAPSKFMAPFFRSMSLDYPDILFLRVDMDELKEIAAKLNVKAM 64 Q ++ +V HF+A WC PS M PFF + DYPD LFL VD+DE+KE+A K ++KAM Sbjct: 26 QASNQNSPIVVHFTASWCMPSVAMIPFFEEFASDYPDFLFLSVDVDEVKEVATKNDIKAM 85 Query: 63 PTFLLMK 43 PTFLL+K Sbjct: 86 PTFLLLK 92 >ref|XP_003593373.1| Thioredoxin-like protein [Medicago truncatula] gi|217072730|gb|ACJ84725.1| unknown [Medicago truncatula] gi|217073240|gb|ACJ84979.1| unknown [Medicago truncatula] gi|269315894|gb|ACZ37073.1| thioredoxin h9 [Medicago truncatula] gi|355482421|gb|AES63624.1| Thioredoxin-like protein [Medicago truncatula] Length = 124 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/67 (55%), Positives = 48/67 (71%) Frame = -3 Query: 243 QHQSKXXXMVAHFSADWCAPSKFMAPFFRSMSLDYPDILFLRVDMDELKEIAAKLNVKAM 64 Q ++ +V HF+A WC PS M PFF + DYPD LFL VD+DE+KE+A K ++KAM Sbjct: 26 QASNQNSPIVVHFTASWCMPSVAMIPFFEEFASDYPDFLFLSVDVDEVKEVATKNDIKAM 85 Query: 63 PTFLLMK 43 PTFLL+K Sbjct: 86 PTFLLLK 92 >ref|XP_004309657.1| PREDICTED: thioredoxin-like protein CXXS1-like [Fragaria vesca subsp. vesca] Length = 128 Score = 82.8 bits (203), Expect = 4e-14 Identities = 35/68 (51%), Positives = 51/68 (75%) Frame = -3 Query: 219 MVAHFSADWCAPSKFMAPFFRSMSLDYPDILFLRVDMDELKEIAAKLNVKAMPTFLLMKP 40 +V HF+A WC PS M P F ++ YPD+LFL VD+DE+KE+A +L++KAMPTFL+MK Sbjct: 38 IVVHFTASWCMPSVAMNPLFEELASSYPDVLFLAVDVDEVKEVATRLDIKAMPTFLVMKE 97 Query: 39 QEGLEEQV 16 + +++ V Sbjct: 98 GKQIDKVV 105 >ref|XP_004505427.1| PREDICTED: thioredoxin-like protein CXXS1-like isoform X1 [Cicer arietinum] gi|502143689|ref|XP_004505428.1| PREDICTED: thioredoxin-like protein CXXS1-like isoform X2 [Cicer arietinum] gi|502143692|ref|XP_004505429.1| PREDICTED: thioredoxin-like protein CXXS1-like isoform X3 [Cicer arietinum] gi|502143695|ref|XP_004505430.1| PREDICTED: thioredoxin-like protein CXXS1-like isoform X4 [Cicer arietinum] Length = 133 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/73 (49%), Positives = 53/73 (72%) Frame = -3 Query: 234 SKXXXMVAHFSADWCAPSKFMAPFFRSMSLDYPDILFLRVDMDELKEIAAKLNVKAMPTF 55 +K ++ HFSA WC PS M PFF M+ Y D++FL+VD+DE+KE+A+K+ +KAMPTF Sbjct: 27 NKGCLVMVHFSAYWCMPSIAMNPFFEEMASTYQDVIFLKVDVDEVKEVASKMEIKAMPTF 86 Query: 54 LLMKPQEGLEEQV 16 LLM + +++ V Sbjct: 87 LLMSGRTPVDKAV 99 >ref|XP_004485661.1| PREDICTED: thioredoxin-like protein CXXS1-like isoform X1 [Cicer arietinum] gi|502077474|ref|XP_004485662.1| PREDICTED: thioredoxin-like protein CXXS1-like isoform X2 [Cicer arietinum] Length = 124 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/80 (48%), Positives = 53/80 (66%) Frame = -3 Query: 255 SQGRQHQSKXXXMVAHFSADWCAPSKFMAPFFRSMSLDYPDILFLRVDMDELKEIAAKLN 76 +Q H S +V HF+A WC PS M P+F ++ +YPD LFL VD+DE+KE+A K + Sbjct: 25 NQASNHNS---LIVVHFTASWCMPSVAMIPYFEELASNYPDFLFLSVDVDEVKEVATKND 81 Query: 75 VKAMPTFLLMKPQEGLEEQV 16 +KAMPTFL +K LE+ V Sbjct: 82 IKAMPTFLFLKDGAPLEKLV 101