BLASTX nr result
ID: Ephedra26_contig00009942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00009942 (654 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006840930.1| hypothetical protein AMTR_s00087p00169870 [A... 57 6e-06 >ref|XP_006840930.1| hypothetical protein AMTR_s00087p00169870 [Amborella trichopoda] gi|548842785|gb|ERN02605.1| hypothetical protein AMTR_s00087p00169870 [Amborella trichopoda] Length = 321 Score = 56.6 bits (135), Expect = 6e-06 Identities = 30/37 (81%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Frame = +2 Query: 20 ATPPLPTSPFSGKAVVHLTKIHTE-GKGSITIMRTKG 127 A+P PTS FSGK VV LTKIHTE GKGSITIMRTKG Sbjct: 285 ASPSYPTSAFSGKPVVALTKIHTEGGKGSITIMRTKG 321