BLASTX nr result
ID: Ephedra26_contig00009755
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00009755 (562 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK23529.1| unknown [Picea sitchensis] 62 1e-07 gb|ABK23284.1| unknown [Picea sitchensis] gi|224285955|gb|ACN406... 62 1e-07 ref|XP_002465339.1| hypothetical protein SORBIDRAFT_01g036770 [S... 56 5e-06 ref|YP_002607632.1| co-chaperone protein DnaJ [Nautilia profundi... 56 7e-06 ref|YP_001356422.1| co-chaperone-curved DNA binding protein A [N... 56 7e-06 >gb|ABK23529.1| unknown [Picea sitchensis] Length = 177 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/50 (62%), Positives = 35/50 (70%) Frame = -1 Query: 163 RTRLNAVSSESYSIRSMSLYEVLGIEEDVGVDDIKQAYRQLVRKYHPDVC 14 R LN+V R S YE+LGI EDVG+ DIKQAYRQ+ RKYHPDVC Sbjct: 34 RALLNSVE------RPPSFYELLGISEDVGLRDIKQAYRQMARKYHPDVC 77 >gb|ABK23284.1| unknown [Picea sitchensis] gi|224285955|gb|ACN40690.1| unknown [Picea sitchensis] Length = 211 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/50 (62%), Positives = 35/50 (70%) Frame = -1 Query: 163 RTRLNAVSSESYSIRSMSLYEVLGIEEDVGVDDIKQAYRQLVRKYHPDVC 14 R LN+V R S YE+LGI EDVG+ DIKQAYRQ+ RKYHPDVC Sbjct: 68 RALLNSVE------RPPSFYELLGISEDVGLRDIKQAYRQMARKYHPDVC 111 >ref|XP_002465339.1| hypothetical protein SORBIDRAFT_01g036770 [Sorghum bicolor] gi|241919193|gb|EER92337.1| hypothetical protein SORBIDRAFT_01g036770 [Sorghum bicolor] Length = 150 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/53 (49%), Positives = 36/53 (67%) Frame = -1 Query: 172 HQNRTRLNAVSSESYSIRSMSLYEVLGIEEDVGVDDIKQAYRQLVRKYHPDVC 14 HQ R+R+ VS+ RS ++YEVL +EE G D+IK AYR+ R++HPD C Sbjct: 21 HQRRSRVR-VSAAPAPARSATMYEVLAVEETAGPDEIKAAYRRAARRWHPDAC 72 >ref|YP_002607632.1| co-chaperone protein DnaJ [Nautilia profundicola AmH] gi|506382868|ref|WP_015902587.1| cobalamin ABC transporter permease [Nautilia profundicola] gi|223589799|gb|ACM93535.1| co-chaperone protein DnaJ [Nautilia profundicola AmH] Length = 285 Score = 55.8 bits (133), Expect = 7e-06 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = -1 Query: 118 SMSLYEVLGIEEDVGVDDIKQAYRQLVRKYHPDVCSQDD 2 S SLYEVLG+ E+ D+IK+AYR+L RKYHPD+C + + Sbjct: 2 SKSLYEVLGVSENATQDEIKKAYRKLARKYHPDICKKPE 40 >ref|YP_001356422.1| co-chaperone-curved DNA binding protein A [Nitratiruptor sp. SB155-2] gi|501030245|ref|WP_012082328.1| cobalamin ABC transporter permease [Nitratiruptor sp. SB155-2] gi|151422561|dbj|BAF70065.1| co-chaperone-curved DNA binding protein A [Nitratiruptor sp. SB155-2] Length = 299 Score = 55.8 bits (133), Expect = 7e-06 Identities = 22/39 (56%), Positives = 29/39 (74%) Frame = -1 Query: 118 SMSLYEVLGIEEDVGVDDIKQAYRQLVRKYHPDVCSQDD 2 S SLYE LG+ D D+IK+AYR+L RKYHPD+C + + Sbjct: 2 SKSLYETLGVSPDASADEIKKAYRKLARKYHPDICKEPE 40