BLASTX nr result
ID: Ephedra26_contig00009693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00009693 (481 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006854080.1| hypothetical protein AMTR_s00048p00122750 [A... 59 5e-07 ref|XP_006849443.1| hypothetical protein AMTR_s00024p00059840 [A... 57 2e-06 >ref|XP_006854080.1| hypothetical protein AMTR_s00048p00122750 [Amborella trichopoda] gi|548857749|gb|ERN15547.1| hypothetical protein AMTR_s00048p00122750 [Amborella trichopoda] Length = 607 Score = 59.3 bits (142), Expect = 5e-07 Identities = 34/89 (38%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = -3 Query: 266 METKKTKLL---RRVDIDLKQKRAVKYAAYLTSFSKSKISKGVRKCNLNAGLLNSCPDDK 96 ME K + L +RV DLK+KRA + A+Y ++ + +S G ++ N L Sbjct: 1 MEVKNGRALGDCKRVHDDLKRKRAARCASYFSNIACPLLSYGSKEQFPNKRLKQELLTTN 60 Query: 95 LIKCCSGKAIVNNYANFNKSSLPVRVMYF 9 KCCS K+++ NYANF KS LP R+M++ Sbjct: 61 GSKCCSKKSLIRNYANFLKSGLPERLMFY 89 >ref|XP_006849443.1| hypothetical protein AMTR_s00024p00059840 [Amborella trichopoda] gi|548853018|gb|ERN11024.1| hypothetical protein AMTR_s00024p00059840 [Amborella trichopoda] Length = 733 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 4/78 (5%) Frame = -3 Query: 227 IDLKQKRAVKYAAYLTSFSKSKIS----KGVRKCNLNAGLLNSCPDDKLIKCCSGKAIVN 60 + L++KRA +YAAY + ++S++S KG+ NSC ++C S K+IVN Sbjct: 100 VALRRKRAARYAAYFSGSARSQLSRSKSKGIYGKPCERESFNSCIHG--LRCSSVKSIVN 157 Query: 59 NYANFNKSSLPVRVMYFS 6 NY NF KS LP R+MY S Sbjct: 158 NYENFLKSGLPRRLMYLS 175