BLASTX nr result
ID: Ephedra26_contig00009274
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00009274 (407 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001753624.1| predicted protein [Physcomitrella patens] gi... 57 2e-06 ref|XP_006841255.1| hypothetical protein AMTR_s00135p00092810 [A... 56 6e-06 ref|XP_004229526.1| PREDICTED: phosphoribosylaminoimidazole-succ... 55 7e-06 >ref|XP_001753624.1| predicted protein [Physcomitrella patens] gi|162695031|gb|EDQ81376.1| predicted protein [Physcomitrella patens] Length = 342 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/38 (60%), Positives = 33/38 (86%) Frame = -2 Query: 406 LAWRYIFLYETITGLQFSLPEFKDSIHDRLTKNLKDAL 293 L+WRYI LYETITG +F LP+ K+++HDR+ +N++DAL Sbjct: 301 LSWRYIVLYETITGTKFVLPDVKENLHDRIIRNVQDAL 338 >ref|XP_006841255.1| hypothetical protein AMTR_s00135p00092810 [Amborella trichopoda] gi|548843171|gb|ERN02930.1| hypothetical protein AMTR_s00135p00092810 [Amborella trichopoda] Length = 389 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/41 (53%), Positives = 33/41 (80%) Frame = -2 Query: 406 LAWRYIFLYETITGLQFSLPEFKDSIHDRLTKNLKDALLQI 284 LAWRYIFL+ETIT QF +P+ ++ IHDR+++N+ LL++ Sbjct: 347 LAWRYIFLFETITRTQFKVPQLEEPIHDRISRNVSQELLEL 387 >ref|XP_004229526.1| PREDICTED: phosphoribosylaminoimidazole-succinocarboxamide synthase, chloroplastic-like [Solanum lycopersicum] Length = 395 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/38 (57%), Positives = 31/38 (81%) Frame = -2 Query: 406 LAWRYIFLYETITGLQFSLPEFKDSIHDRLTKNLKDAL 293 LAWRYIFL+ETIT +F +PE K+ +HDR+++N+ AL Sbjct: 354 LAWRYIFLFETITNSRFEMPETKEPVHDRISRNVSQAL 391