BLASTX nr result
ID: Ephedra26_contig00009237
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00009237 (935 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844973.1| hypothetical protein AMTR_s00058p00182990 [A... 70 9e-10 >ref|XP_006844973.1| hypothetical protein AMTR_s00058p00182990 [Amborella trichopoda] gi|548847464|gb|ERN06648.1| hypothetical protein AMTR_s00058p00182990 [Amborella trichopoda] Length = 286 Score = 70.5 bits (171), Expect = 9e-10 Identities = 37/94 (39%), Positives = 55/94 (58%), Gaps = 2/94 (2%) Frame = +2 Query: 536 DPPSILVLGFDNHGRSSFINTMFRACYREEGPLLM*AQTDP--TPQTTRSRMLYALHNTF 709 +PP+I +LGF +HG+SS +NTM R Y EEGPL++ A+T P TT ++ N F Sbjct: 57 NPPTIFLLGFHDHGKSSLVNTMCRVLYGEEGPLILRAETAPHCLLSTTSRHKRVSVRNPF 116 Query: 710 LPHPETLLNLIDTPSLAITTSANEVCISNALKGV 811 +PE +++L+DTP L + + LK V Sbjct: 117 GGNPENIISLVDTPPLPAADKLLKSDVKTLLKVV 150