BLASTX nr result
ID: Ephedra26_contig00008745
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00008745 (764 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330328.1| predicted protein [Populus trichocarpa] gi|5... 81 3e-13 gb|ABK95605.1| unknown [Populus trichocarpa] 81 3e-13 dbj|BAB55003.1| nitrite reductase [Prunus persica] 80 1e-12 gb|EMJ02379.1| hypothetical protein PRUPE_ppa003315mg [Prunus pe... 80 1e-12 gb|ABR13308.1| putative nitrite reductase [Prunus dulcis] 80 1e-12 ref|XP_004505220.1| PREDICTED: ferredoxin--nitrite reductase, ch... 78 3e-12 ref|XP_003607969.1| Ferredoxin-nitrite reductase [Medicago trunc... 78 3e-12 ref|XP_006349625.1| PREDICTED: ferredoxin--nitrite reductase, ch... 78 4e-12 ref|XP_004248736.1| PREDICTED: ferredoxin--nitrite reductase, ch... 78 4e-12 dbj|BAE46578.1| nitrite reductase [Solanum lycopersicum] 78 4e-12 prf||1908371C nitrite reductase 77 5e-12 dbj|BAD15364.1| nitrite reductase [Nicotiana tabacum] 77 5e-12 dbj|BAD15365.1| nitrite reductase [Nicotiana tabacum] 77 5e-12 emb|CAA46941.1| ferredoxin--nitrite reductase [Nicotiana tabacum] 77 5e-12 pdb|3B0H|A Chain A, Assimilatory Nitrite Reductase (Nii4) From T... 77 5e-12 gb|ESW28506.1| hypothetical protein PHAVU_003G292100g [Phaseolus... 77 6e-12 ref|XP_006423019.1| hypothetical protein CICLE_v10028067mg [Citr... 77 6e-12 ref|XP_006409539.1| hypothetical protein EUTSA_v10022613mg [Eutr... 77 6e-12 gb|AAB50233.1| nitrite reductase [Glycine max] 77 6e-12 gb|AAN31831.1| putative ferredoxin--nitrite reductase [Arabidops... 77 6e-12 >ref|XP_002330328.1| predicted protein [Populus trichocarpa] gi|566166559|ref|XP_006384408.1| Ferredoxin--nitrite reductase family protein [Populus trichocarpa] gi|550341026|gb|ERP62205.1| Ferredoxin--nitrite reductase family protein [Populus trichocarpa] Length = 588 Score = 81.3 bits (199), Expect = 3e-13 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = +3 Query: 3 WISADDIVPSCKAVLEAYRDLGTRGNRQKTRMMWLIDE 116 W+SADD++PSCKAVLEAYRDLGTRGNRQKTRMMWLIDE Sbjct: 304 WVSADDVLPSCKAVLEAYRDLGTRGNRQKTRMMWLIDE 341 >gb|ABK95605.1| unknown [Populus trichocarpa] Length = 588 Score = 81.3 bits (199), Expect = 3e-13 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = +3 Query: 3 WISADDIVPSCKAVLEAYRDLGTRGNRQKTRMMWLIDE 116 W+SADD++PSCKAVLEAYRDLGTRGNRQKTRMMWLIDE Sbjct: 304 WVSADDVLPSCKAVLEAYRDLGTRGNRQKTRMMWLIDE 341 >dbj|BAB55003.1| nitrite reductase [Prunus persica] Length = 532 Score = 79.7 bits (195), Expect = 1e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +3 Query: 3 WISADDIVPSCKAVLEAYRDLGTRGNRQKTRMMWLIDE 116 W+SADD++P CKAVLEAYRDLGTRGNRQKTRMMWLIDE Sbjct: 248 WVSADDVIPLCKAVLEAYRDLGTRGNRQKTRMMWLIDE 285 >gb|EMJ02379.1| hypothetical protein PRUPE_ppa003315mg [Prunus persica] Length = 585 Score = 79.7 bits (195), Expect = 1e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +3 Query: 3 WISADDIVPSCKAVLEAYRDLGTRGNRQKTRMMWLIDE 116 W+SADD++P CKAVLEAYRDLGTRGNRQKTRMMWLIDE Sbjct: 301 WVSADDVIPLCKAVLEAYRDLGTRGNRQKTRMMWLIDE 338 >gb|ABR13308.1| putative nitrite reductase [Prunus dulcis] Length = 271 Score = 79.7 bits (195), Expect = 1e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +3 Query: 3 WISADDIVPSCKAVLEAYRDLGTRGNRQKTRMMWLIDE 116 W+SADD++P CKAVLEAYRDLGTRGNRQKTRMMWLIDE Sbjct: 128 WVSADDVIPLCKAVLEAYRDLGTRGNRQKTRMMWLIDE 165 >ref|XP_004505220.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like [Cicer arietinum] Length = 582 Score = 78.2 bits (191), Expect = 3e-12 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +3 Query: 3 WISADDIVPSCKAVLEAYRDLGTRGNRQKTRMMWLIDE 116 W+SADD++P CKAVLE YRDLGTRGNRQKTRMMWLIDE Sbjct: 298 WVSADDVIPLCKAVLETYRDLGTRGNRQKTRMMWLIDE 335 >ref|XP_003607969.1| Ferredoxin-nitrite reductase [Medicago truncatula] gi|355509024|gb|AES90166.1| Ferredoxin-nitrite reductase [Medicago truncatula] Length = 582 Score = 78.2 bits (191), Expect = 3e-12 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +3 Query: 3 WISADDIVPSCKAVLEAYRDLGTRGNRQKTRMMWLIDE 116 W+SADD++P CKAVLE YRDLGTRGNRQKTRMMWLIDE Sbjct: 298 WVSADDVIPLCKAVLETYRDLGTRGNRQKTRMMWLIDE 335 >ref|XP_006349625.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like [Solanum tuberosum] Length = 584 Score = 77.8 bits (190), Expect = 4e-12 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +3 Query: 3 WISADDIVPSCKAVLEAYRDLGTRGNRQKTRMMWLIDE 116 W+ ADD+VP CKA+LEAYRDLGTRGNRQKTRMMWLIDE Sbjct: 301 WVPADDVVPVCKAILEAYRDLGTRGNRQKTRMMWLIDE 338 >ref|XP_004248736.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Solanum lycopersicum] Length = 584 Score = 77.8 bits (190), Expect = 4e-12 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +3 Query: 3 WISADDIVPSCKAVLEAYRDLGTRGNRQKTRMMWLIDE 116 W+ ADD+VP CKA+LEAYRDLGTRGNRQKTRMMWLIDE Sbjct: 301 WVPADDVVPVCKAILEAYRDLGTRGNRQKTRMMWLIDE 338 >dbj|BAE46578.1| nitrite reductase [Solanum lycopersicum] Length = 234 Score = 77.8 bits (190), Expect = 4e-12 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +3 Query: 3 WISADDIVPSCKAVLEAYRDLGTRGNRQKTRMMWLIDE 116 W+ ADD+VP CKA+LEAYRDLGTRGNRQKTRMMWLIDE Sbjct: 188 WVPADDVVPVCKAILEAYRDLGTRGNRQKTRMMWLIDE 225 >prf||1908371C nitrite reductase Length = 347 Score = 77.4 bits (189), Expect = 5e-12 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +3 Query: 3 WISADDIVPSCKAVLEAYRDLGTRGNRQKTRMMWLIDE 116 W+ ADD+VP CKA+LEAYRDLGTRGNRQKTRMMWL+DE Sbjct: 142 WVPADDVVPVCKAILEAYRDLGTRGNRQKTRMMWLVDE 179 >dbj|BAD15364.1| nitrite reductase [Nicotiana tabacum] Length = 584 Score = 77.4 bits (189), Expect = 5e-12 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +3 Query: 3 WISADDIVPSCKAVLEAYRDLGTRGNRQKTRMMWLIDE 116 W+ ADD+VP CKA+LEAYRDLGTRGNRQKTRMMWL+DE Sbjct: 301 WVPADDVVPVCKAILEAYRDLGTRGNRQKTRMMWLVDE 338 >dbj|BAD15365.1| nitrite reductase [Nicotiana tabacum] Length = 587 Score = 77.4 bits (189), Expect = 5e-12 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +3 Query: 3 WISADDIVPSCKAVLEAYRDLGTRGNRQKTRMMWLIDE 116 W+ ADD+VP CKA+LEAYRDLGTRGNRQKTRMMWL+DE Sbjct: 304 WVPADDVVPVCKAILEAYRDLGTRGNRQKTRMMWLVDE 341 >emb|CAA46941.1| ferredoxin--nitrite reductase [Nicotiana tabacum] Length = 348 Score = 77.4 bits (189), Expect = 5e-12 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +3 Query: 3 WISADDIVPSCKAVLEAYRDLGTRGNRQKTRMMWLIDE 116 W+ ADD+VP CKA+LEAYRDLGTRGNRQKTRMMWL+DE Sbjct: 142 WVPADDVVPVCKAILEAYRDLGTRGNRQKTRMMWLVDE 179 >pdb|3B0H|A Chain A, Assimilatory Nitrite Reductase (Nii4) From Tobbaco Root gi|377656225|pdb|3B0H|B Chain B, Assimilatory Nitrite Reductase (Nii4) From Tobbaco Root Length = 588 Score = 77.4 bits (189), Expect = 5e-12 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +3 Query: 3 WISADDIVPSCKAVLEAYRDLGTRGNRQKTRMMWLIDE 116 W+ ADD+VP CKA+LEAYRDLGTRGNRQKTRMMWL+DE Sbjct: 305 WVPADDVVPVCKAILEAYRDLGTRGNRQKTRMMWLVDE 342 >gb|ESW28506.1| hypothetical protein PHAVU_003G292100g [Phaseolus vulgaris] Length = 582 Score = 77.0 bits (188), Expect = 6e-12 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +3 Query: 3 WISADDIVPSCKAVLEAYRDLGTRGNRQKTRMMWLIDE 116 W+SADD++P CKAVLEAYRDLG RGNRQKTRMMWLIDE Sbjct: 299 WVSADDVIPVCKAVLEAYRDLGFRGNRQKTRMMWLIDE 336 >ref|XP_006423019.1| hypothetical protein CICLE_v10028067mg [Citrus clementina] gi|557524953|gb|ESR36259.1| hypothetical protein CICLE_v10028067mg [Citrus clementina] Length = 595 Score = 77.0 bits (188), Expect = 6e-12 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +3 Query: 3 WISADDIVPSCKAVLEAYRDLGTRGNRQKTRMMWLIDE 116 W++ADD++P CKAVLEAYRDLG+RGNRQKTRMMWLIDE Sbjct: 312 WVAADDVIPVCKAVLEAYRDLGSRGNRQKTRMMWLIDE 349 >ref|XP_006409539.1| hypothetical protein EUTSA_v10022613mg [Eutrema salsugineum] gi|557110701|gb|ESQ50992.1| hypothetical protein EUTSA_v10022613mg [Eutrema salsugineum] Length = 590 Score = 77.0 bits (188), Expect = 6e-12 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +3 Query: 3 WISADDIVPSCKAVLEAYRDLGTRGNRQKTRMMWLIDE 116 W+ ADD++P CKAVLEAYRDLGTRGNRQKTRMMWLIDE Sbjct: 305 WVPADDVLPLCKAVLEAYRDLGTRGNRQKTRMMWLIDE 342 >gb|AAB50233.1| nitrite reductase [Glycine max] Length = 596 Score = 77.0 bits (188), Expect = 6e-12 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +3 Query: 3 WISADDIVPSCKAVLEAYRDLGTRGNRQKTRMMWLIDE 116 W+SADD++P CKAVLEAYRDLG RGNRQKTRMMWLIDE Sbjct: 312 WVSADDVIPLCKAVLEAYRDLGFRGNRQKTRMMWLIDE 349 >gb|AAN31831.1| putative ferredoxin--nitrite reductase [Arabidopsis thaliana] Length = 586 Score = 77.0 bits (188), Expect = 6e-12 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +3 Query: 3 WISADDIVPSCKAVLEAYRDLGTRGNRQKTRMMWLIDE 116 W+ ADD++P CKAVLEAYRDLGTRGNRQKTRMMWLIDE Sbjct: 302 WVPADDVLPLCKAVLEAYRDLGTRGNRQKTRMMWLIDE 339