BLASTX nr result
ID: Ephedra26_contig00008672
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00008672 (538 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006845248.1| hypothetical protein AMTR_s00005p00261220 [A... 56 5e-06 >ref|XP_006845248.1| hypothetical protein AMTR_s00005p00261220 [Amborella trichopoda] gi|548847761|gb|ERN06923.1| hypothetical protein AMTR_s00005p00261220 [Amborella trichopoda] Length = 466 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/62 (40%), Positives = 42/62 (67%) Frame = -3 Query: 536 LRLWRCRKLTDVSMYSIIQTCSMLEVLDIDRCDSISTNAVFFLVLQCPRLTRVVVEGFKV 357 ++L CR LTD ++S+ ++C L+ LDI +C IST A+ FL+L +L R++VE K+ Sbjct: 391 IKLRGCRGLTDNVVFSVFKSCQSLKTLDIAKCHKISTEAIEFLILNSSKLQRILVEDSKL 450 Query: 356 TE 351 ++ Sbjct: 451 SD 452