BLASTX nr result
ID: Ephedra26_contig00008586
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00008586 (1461 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523324.1| conserved hypothetical protein [Ricinus comm... 59 5e-06 >ref|XP_002523324.1| conserved hypothetical protein [Ricinus communis] gi|223537412|gb|EEF39040.1| conserved hypothetical protein [Ricinus communis] Length = 239 Score = 58.9 bits (141), Expect = 5e-06 Identities = 26/55 (47%), Positives = 36/55 (65%) Frame = +2 Query: 599 ESQEHLRSPPRLPILTKPLWVLQAEASGMMTPPFGSAGSVPFKWEETPGKAKPSS 763 E++ S PRLP+ KP +V + SGM+TPP S+ +VPF+WEE PGK + S Sbjct: 4 EAEAEDSSTPRLPLFLKPPYVQSPQRSGMLTPPLYSSAAVPFRWEEEPGKPRECS 58