BLASTX nr result
ID: Ephedra26_contig00007824
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00007824 (421 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006351910.1| PREDICTED: long chain acyl-CoA synthetase 9,... 63 5e-08 ref|XP_004250394.1| PREDICTED: long chain acyl-CoA synthetase 9,... 63 5e-08 ref|XP_004978798.1| PREDICTED: long chain acyl-CoA synthetase 9,... 61 1e-07 gb|AFW65376.1| hypothetical protein ZEAMMB73_821294 [Zea mays] 61 1e-07 ref|XP_002449082.1| hypothetical protein SORBIDRAFT_05g004500 [S... 61 1e-07 gb|ESW09404.1| hypothetical protein PHAVU_009G124800g [Phaseolus... 60 2e-07 gb|EPS70446.1| hypothetical protein M569_04312, partial [Genlise... 60 4e-07 ref|XP_004498339.1| PREDICTED: long chain acyl-CoA synthetase 9,... 60 4e-07 ref|XP_004498338.1| PREDICTED: long chain acyl-CoA synthetase 9,... 60 4e-07 ref|XP_004498337.1| PREDICTED: long chain acyl-CoA synthetase 9,... 60 4e-07 ref|XP_003589582.1| Annotation was added to scaffolds in Novembe... 60 4e-07 ref|XP_004977279.1| PREDICTED: long chain acyl-CoA synthetase 9,... 59 5e-07 gb|EMT33144.1| Long-chain-fatty-acid--CoA ligase 4 [Aegilops tau... 59 5e-07 gb|EMS61973.1| Long chain acyl-CoA synthetase 9, chloroplastic [... 59 5e-07 gb|ADV16378.1| long-chain acyl-CoA synthetase 1 [Helianthus annuus] 59 5e-07 gb|AFW56177.1| hypothetical protein ZEAMMB73_064891 [Zea mays] 59 5e-07 dbj|BAK00838.1| predicted protein [Hordeum vulgare subsp. vulgare] 59 5e-07 dbj|BAE71220.1| putative long chain acyl-CoA synthetase 9 [Trifo... 59 7e-07 ref|XP_006857754.1| hypothetical protein AMTR_s00061p00196410 [A... 59 9e-07 ref|XP_003526630.1| PREDICTED: long chain acyl-CoA synthetase 9,... 59 9e-07 >ref|XP_006351910.1| PREDICTED: long chain acyl-CoA synthetase 9, chloroplastic-like [Solanum tuberosum] Length = 696 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +3 Query: 33 ASMNQAYGLTKTCVKGTFSGYSDTAAGCVGPPLPCSYVKI 152 A + Q YGLT+TC GTFS Y DT+ G VGPPLPCSY+K+ Sbjct: 445 APIGQGYGLTETCAGGTFSDYDDTSVGRVGPPLPCSYIKL 484 >ref|XP_004250394.1| PREDICTED: long chain acyl-CoA synthetase 9, chloroplastic-like [Solanum lycopersicum] Length = 696 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +3 Query: 33 ASMNQAYGLTKTCVKGTFSGYSDTAAGCVGPPLPCSYVKI 152 A + Q YGLT+TC GTFS Y DT+ G VGPPLPCSY+K+ Sbjct: 445 APIGQGYGLTETCAGGTFSDYDDTSVGRVGPPLPCSYIKL 484 >ref|XP_004978798.1| PREDICTED: long chain acyl-CoA synthetase 9, chloroplastic-like [Setaria italica] Length = 697 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +3 Query: 33 ASMNQAYGLTKTCVKGTFSGYSDTAAGCVGPPLPCSYVKI 152 A ++Q YGLT+TC GTFS Y +T+ G VGPPLPCSY+K+ Sbjct: 447 APISQGYGLTETCAGGTFSEYDETSVGRVGPPLPCSYIKL 486 >gb|AFW65376.1| hypothetical protein ZEAMMB73_821294 [Zea mays] Length = 671 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +3 Query: 33 ASMNQAYGLTKTCVKGTFSGYSDTAAGCVGPPLPCSYVKI 152 A ++Q YGLT+TC GTFS Y +T+ G VGPPLPCSY+K+ Sbjct: 420 APISQGYGLTETCAGGTFSEYDETSVGRVGPPLPCSYIKL 459 >ref|XP_002449082.1| hypothetical protein SORBIDRAFT_05g004500 [Sorghum bicolor] gi|241934925|gb|EES08070.1| hypothetical protein SORBIDRAFT_05g004500 [Sorghum bicolor] Length = 469 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +3 Query: 33 ASMNQAYGLTKTCVKGTFSGYSDTAAGCVGPPLPCSYVKI 152 A ++Q YGLT+TC GTFS Y +T+ G VGPPLPCSY+K+ Sbjct: 219 APISQGYGLTETCAGGTFSEYDETSVGRVGPPLPCSYIKL 258 >gb|ESW09404.1| hypothetical protein PHAVU_009G124800g [Phaseolus vulgaris] Length = 694 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +3 Query: 33 ASMNQAYGLTKTCVKGTFSGYSDTAAGCVGPPLPCSYVKI 152 A + Q YGLT+TC GTFS + DT+ G VGPP+PCSY+K+ Sbjct: 442 APIGQGYGLTETCAGGTFSDFDDTSVGRVGPPIPCSYIKL 481 >gb|EPS70446.1| hypothetical protein M569_04312, partial [Genlisea aurea] Length = 696 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = +3 Query: 33 ASMNQAYGLTKTCVKGTFSGYSDTAAGCVGPPLPCSYVKI 152 A + Q YGLT+TC GTFS Y DT+ G VGPPLPCS VK+ Sbjct: 445 APIGQGYGLTETCAGGTFSEYDDTSVGRVGPPLPCSIVKL 484 >ref|XP_004498339.1| PREDICTED: long chain acyl-CoA synthetase 9, chloroplastic-like isoform X3 [Cicer arietinum] Length = 535 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +3 Query: 33 ASMNQAYGLTKTCVKGTFSGYSDTAAGCVGPPLPCSYVKI 152 A + Q YGLT+TC GTFS + DT+ G VGPPLPCS++K+ Sbjct: 284 APIGQGYGLTETCAGGTFSDFDDTSVGRVGPPLPCSFIKL 323 >ref|XP_004498338.1| PREDICTED: long chain acyl-CoA synthetase 9, chloroplastic-like isoform X2 [Cicer arietinum] Length = 694 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +3 Query: 33 ASMNQAYGLTKTCVKGTFSGYSDTAAGCVGPPLPCSYVKI 152 A + Q YGLT+TC GTFS + DT+ G VGPPLPCS++K+ Sbjct: 443 APIGQGYGLTETCAGGTFSDFDDTSVGRVGPPLPCSFIKL 482 >ref|XP_004498337.1| PREDICTED: long chain acyl-CoA synthetase 9, chloroplastic-like isoform X1 [Cicer arietinum] Length = 694 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +3 Query: 33 ASMNQAYGLTKTCVKGTFSGYSDTAAGCVGPPLPCSYVKI 152 A + Q YGLT+TC GTFS + DT+ G VGPPLPCS++K+ Sbjct: 443 APIGQGYGLTETCAGGTFSDFDDTSVGRVGPPLPCSFIKL 482 >ref|XP_003589582.1| Annotation was added to scaffolds in November 2011~Long-chain-fatty-acid-CoA ligase [Medicago truncatula] gi|355478630|gb|AES59833.1| Annotation was added to scaffolds in November 2011~Long-chain-fatty-acid-CoA ligase [Medicago truncatula] Length = 696 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +3 Query: 33 ASMNQAYGLTKTCVKGTFSGYSDTAAGCVGPPLPCSYVKI 152 A + Q YGLT+TC GTFS + DT+ G VGPPLPCS++K+ Sbjct: 445 APIGQGYGLTETCAGGTFSDFDDTSVGRVGPPLPCSFIKL 484 >ref|XP_004977279.1| PREDICTED: long chain acyl-CoA synthetase 9, chloroplastic-like [Setaria italica] Length = 698 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +3 Query: 33 ASMNQAYGLTKTCVKGTFSGYSDTAAGCVGPPLPCSYVKI 152 A + Q YGLT+TC GTFS Y DT+ G VG PLPCSY+K+ Sbjct: 448 APIGQGYGLTETCAGGTFSEYDDTSVGRVGAPLPCSYIKL 487 >gb|EMT33144.1| Long-chain-fatty-acid--CoA ligase 4 [Aegilops tauschii] Length = 712 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +3 Query: 33 ASMNQAYGLTKTCVKGTFSGYSDTAAGCVGPPLPCSYVKI 152 A + Q YGLT+TC GTFS Y DT+ G VG PLPCSY+K+ Sbjct: 462 APIGQGYGLTETCAGGTFSEYDDTSVGRVGAPLPCSYIKL 501 >gb|EMS61973.1| Long chain acyl-CoA synthetase 9, chloroplastic [Triticum urartu] Length = 704 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +3 Query: 33 ASMNQAYGLTKTCVKGTFSGYSDTAAGCVGPPLPCSYVKI 152 A + Q YGLT+TC GTFS Y DT+ G VG PLPCSY+K+ Sbjct: 454 APIGQGYGLTETCAGGTFSEYDDTSVGRVGAPLPCSYIKL 493 >gb|ADV16378.1| long-chain acyl-CoA synthetase 1 [Helianthus annuus] Length = 697 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +3 Query: 33 ASMNQAYGLTKTCVKGTFSGYSDTAAGCVGPPLPCSYVKI 152 A + Q YGLT+TC GTFS Y DT+ G VG PLPCSY+K+ Sbjct: 446 APIGQGYGLTETCAGGTFSEYDDTSVGRVGAPLPCSYIKL 485 >gb|AFW56177.1| hypothetical protein ZEAMMB73_064891 [Zea mays] Length = 698 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +3 Query: 33 ASMNQAYGLTKTCVKGTFSGYSDTAAGCVGPPLPCSYVKI 152 A + Q YGLT+TC GTFS Y DT+ G VG PLPCSY+K+ Sbjct: 448 APIGQGYGLTETCAGGTFSEYDDTSVGRVGAPLPCSYIKL 487 >dbj|BAK00838.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 698 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +3 Query: 33 ASMNQAYGLTKTCVKGTFSGYSDTAAGCVGPPLPCSYVKI 152 A + Q YGLT+TC GTFS Y DT+ G VG PLPCSY+K+ Sbjct: 448 APIGQGYGLTETCAGGTFSEYDDTSVGRVGAPLPCSYIKL 487 >dbj|BAE71220.1| putative long chain acyl-CoA synthetase 9 [Trifolium pratense] Length = 694 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/40 (57%), Positives = 31/40 (77%) Frame = +3 Query: 33 ASMNQAYGLTKTCVKGTFSGYSDTAAGCVGPPLPCSYVKI 152 A + Q YGLT+TC G+FS + DT+ G VGPP+PCSY+K+ Sbjct: 443 APIGQGYGLTETCAGGSFSDFDDTSVGRVGPPIPCSYIKL 482 >ref|XP_006857754.1| hypothetical protein AMTR_s00061p00196410 [Amborella trichopoda] gi|548861850|gb|ERN19221.1| hypothetical protein AMTR_s00061p00196410 [Amborella trichopoda] Length = 712 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +3 Query: 33 ASMNQAYGLTKTCVKGTFSGYSDTAAGCVGPPLPCSYVKI 152 A + QAYGLT+TC GTFS + D + G VGPPLPC YVK+ Sbjct: 462 APVEQAYGLTETCAGGTFSDWDDESVGRVGPPLPCCYVKL 501 >ref|XP_003526630.1| PREDICTED: long chain acyl-CoA synthetase 9, chloroplastic-like [Glycine max] Length = 694 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/40 (57%), Positives = 31/40 (77%) Frame = +3 Query: 33 ASMNQAYGLTKTCVKGTFSGYSDTAAGCVGPPLPCSYVKI 152 A + Q YGLT+TC G+FS + DT+ G VGPP+PCSY+K+ Sbjct: 443 APIGQGYGLTETCAGGSFSDFDDTSVGRVGPPVPCSYIKL 482