BLASTX nr result
ID: Ephedra26_contig00007174
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00007174 (432 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006838388.1| hypothetical protein AMTR_s00002p00069990 [A... 60 3e-07 ref|XP_006362710.1| PREDICTED: cyclin-dependent kinase E-1-like ... 56 6e-06 >ref|XP_006838388.1| hypothetical protein AMTR_s00002p00069990 [Amborella trichopoda] gi|548840894|gb|ERN00957.1| hypothetical protein AMTR_s00002p00069990 [Amborella trichopoda] Length = 466 Score = 60.1 bits (144), Expect = 3e-07 Identities = 35/61 (57%), Positives = 40/61 (65%) Frame = -1 Query: 306 AFNLGAPGGMSGLHPNNIANLQRASQQAHQQVLHYPPNLRRKDPSGGMQNAGYPPQPKSR 127 AFNL + M+GL+PNNI + RA+ QAHQQ LRRKDP GM N GY PQ KSR Sbjct: 413 AFNLSSQASMAGLNPNNIP-MPRAASQAHQQ------QLRRKDPGMGMPNTGY-PQQKSR 464 Query: 126 R 124 R Sbjct: 465 R 465 >ref|XP_006362710.1| PREDICTED: cyclin-dependent kinase E-1-like isoform X1 [Solanum tuberosum] gi|565394121|ref|XP_006362711.1| PREDICTED: cyclin-dependent kinase E-1-like isoform X2 [Solanum tuberosum] gi|565394123|ref|XP_006362712.1| PREDICTED: cyclin-dependent kinase E-1-like isoform X3 [Solanum tuberosum] gi|565394125|ref|XP_006362713.1| PREDICTED: cyclin-dependent kinase E-1-like isoform X4 [Solanum tuberosum] Length = 467 Score = 55.8 bits (133), Expect = 6e-06 Identities = 34/75 (45%), Positives = 47/75 (62%), Gaps = 2/75 (2%) Frame = -1 Query: 342 LMNIQRMQHQNL-AFNLGAPGGM-SGLHPNNIANLQRASQQAHQQVLHYPPNLRRKDPSG 169 ++N+ RMQ Q + A+NL + GM +G++P N+ + + QAHQQ +RRKDP Sbjct: 400 MVNMPRMQPQGMSAYNLASQAGMGAGMNPGNMPMQRGVAAQAHQQ------QMRRKDP-- 451 Query: 168 GMQNAGYPPQPKSRR 124 GM GYPPQ KSRR Sbjct: 452 GMGIPGYPPQQKSRR 466